KEGG   Mus musculus (mouse): 71586
Entry
71586             CDS       T01002                                 

Gene name
Ifih1, 9130009C22Rik, Heli, Helicard, Hlcd, MDA, MDA-, MDA5, RLR-2
Definition
(RefSeq) interferon induced with helicase C domain 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    71586 (Ifih1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    71586 (Ifih1)
   05171 Coronavirus disease - COVID-19
    71586 (Ifih1)
   05164 Influenza A
    71586 (Ifih1)
   05162 Measles
    71586 (Ifih1)
   05168 Herpes simplex virus 1 infection
    71586 (Ifih1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    71586 (Ifih1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     71586 (Ifih1)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   71586 (Ifih1)
SSDB
Motif
Pfam: RIG-I_C CARD_2 RIG-I_C-RD Helicase_C ResIII DEAD CARD SWI2_SNF2 AAA_19 DUF3638 AAA_22
Other DBs
NCBI-GeneID: 71586
NCBI-ProteinID: NP_082111
MGI: 1918836
Ensembl: ENSMUSG00000026896
Vega: OTTMUSG00000012871
UniProt: Q8R5F7 Q3TGP5 D2CGM4
LinkDB
Structure
PDB: 

Position
2; 2 C1.3
AA seq 1025 aa
MSIVCSAEDSFRNLILFFRPRLKMYIQVEPVLDHLIFLSAETKEQILKKINTCGNTSAAE
LLLSTLEQGQWPLGWTQMFVEALEHSGNPLAARYVKPTLTDLPSPSSETAHDECLHLLTL
LQPTLVDKLLINDVLDTCFEKGLLTVEDRNRISAAGNSGNESGVRELLRRIVQKENWFST
FLDVLRQTGNDALFQELTGGGCPEDNTDLANSSHRDGPAANECLLPAVDESSLETEAWNV
DDILPEASCTDSSVTTESDTSLAEGSVSCFDESLGHNSNMGRDSGTMGSDSDESVIQTKR
VSPEPELQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQASESGKV
IVLVNKVMLAEQLFRKEFNPYLKKWYRIIGLSGDTQLKISFPEVVKSYDVIISTAQILEN
SLLNLESGDDDGVQLSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLRNNDLKKQNKPAI
PLPQILGLTASPGVGAAKKQSEAEKHILNICANLDAFTIKTVKENLGQLKHQIKEPCKKF
VIADDTRENPFKEKLLEIMASIQTYCQKSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDRV
CAEHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNDSDKSDDEASSCNDQLK
GDVKKSLKLDETDEFLMNLFFDNKKMLKKLAENPKYENEKLIKLRNTILEQFTRSEESSR
GIIFTKTRQSTYALSQWIMENAKFAEVGVKAHHLIGAGHSSEVKPMTQTEQKEVISKFRT
GEINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVTSSGSGV
TEREIVNDFREKMMYKAINRVQNMKPEEYAHKILELQVQSILEKKMKVKRSIAKQYNDNP
SLITLLCKNCSMLVCSGENIHVIEKMHHVNMTPEFKGLYIVRENKALQKKFADYQTNGEI
ICKCGQAWGTMMVHKGLDLPCLKIRNFVVNFKNNSPKKQYKKWVELPIRFPDLDYSEYCL
YSDED
NT seq 3078 nt   +upstreamnt  +downstreamnt
atgtcgattgtctgttctgcagaggacagcttcaggaatctcatcttattcttcaggccc
aggctgaaaatgtacattcaggtggagccagtgctggaccacctcatctttctgtctgca
gaaaccaaagagcagattcttaaaaagatcaacacctgtggtaacaccagcgcggcagaa
ctgctgctgagcaccttggagcagggacaatggcctctgggatggacgcagatgttcgtg
gaggccctagagcacagtggcaatcccctagccgcgcgctatgtcaaacccacactcact
gatctgccctctccttcctctgagactgcccatgacgagtgtctccacttgctgaccctc
ctccagcccactttggtggacaaacttctgattaacgatgtcttggacacttgcttcgag
aagggactattgacagtcgaagacagaaatcggatttctgctgcaggaaacagcgggaat
gagtcaggtgtaagagagctgctgagaaggattgtgcagaaggaaaactggttttctacc
ttcctggatgttctgcgccaaactggaaatgatgcactattccaagaactaacaggtgga
ggctgcccagaagacaacacagacttggctaactcgtctcacagagatgggcctgcagct
aatgagtgtcttctgcctgctgtcgatgagtcaagtctggagacagaggcctggaacgta
gacgacatattaccagaggcttcttgtacagattcgtctgtgaccacagaatcagacaca
agtttggcagaaggaagtgtcagctgcttcgatgaaagtcttggacataacagcaacatg
ggcagggattcaggcaccatgggaagtgattcagatgaaagtgtcatccagacaaaaaga
gtatcccccgagccagaactgcagctcaggccttaccaaatggaagtggcccaaccagct
ctagatgggaagaatattattatctgcctccccacggggagtgggaaaaccagagtggct
gtttacatcaccaaagatcacttagacaagaagaagcaggcatctgaatccgggaaggtt
atcgttcttgtcaataaggtaatgttagcagaacaacttttccgaaaagagttcaaccca
tatttgaagaaatggtatcgaattattggattaagtggcgatacccagctgaaaatatca
tttccagaagttgtcaaatcttacgatgttattatcagcactgctcaaatccttgaaaac
tccctcttaaatctggagagtggagacgatgacggtgtgcagctgtcagacttctctctc
attatcattgatgagtgccatcacaccaacaaggaggcagtctataacaacatcatgaga
cgatatttgaagcagaagctgagaaacaatgacctcaagaaacaaaacaaaccagccatt
cccctgccgcagatactaggactgacagcttcacctggtgttggagcagccaaaaagcag
tctgaggctgaaaaacatattttaaatatatgtgccaatcttgatgcctttaccattaaa
acagtgaaagagaatcttggtcaactcaaacaccaaataaaggaaccatgcaagaaattt
gtgattgctgatgacaccagagaaaatccatttaaagagaaacttctagaaattatggca
agcattcagacttactgccaaaaaagtccaatgtcagattttggaacccaacattatgag
cagtgggccattcaaatggagaaaaaagctgctaaagacggaaatcgcaaagatcgcgtc
tgtgcagaacatttgaggaagtacaacgaagccctacaaatcaacgacacgatccgaatg
attgatgcatatagccacctggagacattctacactgatgagaaagaaaagaagttcgca
gtcctcaatgacagcgacaagagtgatgacgaggccagcagttgcaatgaccaacttaag
ggcgatgtaaagaaatctttgaaactggacgaaacggatgaatttctcatgaatttgttc
tttgataacaagaaaatgttgaaaaaactagctgaaaacccaaaatacgagaatgaaaaa
ctcattaaattaagaaacacgatactggaacaattcacaaggtctgaggagtcctcccga
ggaattatttttacaaaaacacgacagagcacctacgcactttcccagtggatcatggaa
aatgcaaagtttgcggaagttggagtcaaagcgcatcacctgattggcgcggggcacagc
agtgaagtcaagcccatgactcagactgaacaaaaagaagtcattagtaaatttcgcact
ggcgaaataaatctgcttatcgctacgacggtggcagaggaaggcctggatatcaaagag
tgcaatattgttattcgttatggccttgtcacgaacgagatagccatggtccaggcccgg
ggtcgagccagagctgatgaaagcacgtatgtcctggtcaccagcagtggctcaggagtt
accgaacgggagattgttaatgatttccgagagaagatgatgtataaagctattaaccgt
gttcaaaacatgaaaccagaggagtatgcacataagattttggaattgcaggtgcaaagt
atcctggaaaagaaaatgaaagtcaaaagaagcattgcaaagcaatacaacgacaatcca
tcgttaataacacttctctgcaaaaattgtagcatgctggtctgctcgggagaaaacatc
catgtcattgagaagatgcatcatgtcaatatgacaccagaattcaagggactctacatt
gtaagagaaaacaaagcactgcaaaagaaatttgctgattatcagaccaatggagagatt
atctgcaagtgtggccaggcttggggaacaatgatggtgcacaaaggtttagatttgcct
tgtcttaaaataaggaattttgtagtcaatttcaaaaataactcaccgaagaaacagtac
aagaagtgggtggaattgcctatcagatttcctgatcttgactactcagaatactgcttg
tatagtgatgaagattag

DBGET integrated database retrieval system