KEGG   Mus musculus (mouse): 71950Help
Entry
71950             CDS       T01002                                 

Gene name
Nanog, 2410002E02Rik, ENK, ecat4
Definition
(RefSeq) Nanog homeobox
  KO
K10164  homeobox protein Nanog
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    71950 (Nanog)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    71950 (Nanog)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    71950 (Nanog)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    71950 (Nanog)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 71950
NCBI-ProteinID: NP_082292
MGI: 1919200
Ensembl: ENSMUSG00000012396
Vega: OTTMUSG00000023511
UniProt: Q80Z64 A2RS90 B7ZN41
LinkDB All DBs
Structure
PDB: 

Position
6; 6 F1
AA seq 305 aa AA seqDB search
MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDL
PLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKY
LSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIH
CSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNG
QPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVT
PPGEI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgggtcttcctggtccccacagtttgcctagttctgaggaagcatcgaattct
gggaacgcctcatcaatgcctgcagtttttcatcccgagaactattcttgcttacaaggg
tctgctactgagatgctctgcacagaggctgcctctcctcgcccttcctctgaagacctg
cctcttcaaggcagccctgattcttctaccagtcccaaacaaaagctctcaagtcctgag
gctgacaagggccctgaggaggaggagaacaaggtccttgccaggaagcagaagatgcgg
actgtgttctctcaggcccagctgtgtgcactcaaggacaggtttcagaagcagaagtac
ctcagcctccagcagatgcaagaactctcctccattctgaacctgagctataagcaggtt
aagacctggtttcaaaaccaaaggatgaagtgcaagcggtggcagaaaaaccagtggttg
aagactagcaatggtctgattcagaagggctcagcaccagtggagtatcccagcatccat
tgcagctatccccagggctatctggtgaacgcatctggaagcctttccatgtggggcagc
cagacttggaccaacccaacttggagcagccagacctggaccaacccaacttggaacaac
cagacctggaccaacccaacttggagcagccaggcctggaccgctcagtcctggaacggc
cagccttggaatgctgctccgctccataacttcggggaggactttctgcagccttacgta
cagttgcagcaaaacttctctgccagtgatttggaggtgaatttggaagccactagggaa
agccatgcgcattttagcaccccacaagccttggaattattcctgaactactctgtgact
ccaccaggtgaaatatga

DBGET integrated database retrieval system