KEGG   Mus musculus (mouse): 72049Help
Entry
72049             CDS       T01002                                 

Gene name
Tnfrsf13c, 2010006P15Rik, BAFF-R, Baffr, Bcmd, Bcmd-1, Bcmd1, Lvis22
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 13c
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05166  Human T-cell leukemia virus 1 infection
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    72049 (Tnfrsf13c)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    72049 (Tnfrsf13c)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    72049 (Tnfrsf13c)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    72049 (Tnfrsf13c)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    72049 (Tnfrsf13c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    72049 (Tnfrsf13c)
   04090 CD molecules [BR:mmu04090]
    72049 (Tnfrsf13c)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   72049 (Tnfrsf13c)
CD molecules [BR:mmu04090]
 Proteins
  72049 (Tnfrsf13c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind TACI-CRD2
Motif
Other DBs
NCBI-GeneID: 72049
NCBI-ProteinID: NP_082351
MGI: 1919299
Ensembl: ENSMUSG00000068105
UniProt: Q9D8D0 Q3SXS6
LinkDB All DBs
Position
15; 15 E1
AA seq 175 aa AA seqDB search
MGARRLRVRSQRSRDSSVPTQCNQTECFDPLVRNCVSCELFHTPDTGHTSSLEPGTALQP
QEGSALRPDVALLVGAPALLGLILALTLVGLVSLVSWRWRQQLRTASPDTSEGVQQESLE
NVFVPSSETPHASAPTWPPLKEDADSALPRHSVPVPATELGSTELVTTKTAGPEQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaggagactccgggtccgaagccagaggagccgggacagctcggtgcccacc
cagtgcaatcagaccgagtgcttcgaccctctggtgagaaactgcgtgtcctgtgagctc
ttccacacgccggacactggacatacaagcagcctggagcctgggacagctctgcagcct
caggagggctccgcgctgagacccgacgtggcgctgctcgtcggtgcccccgcactcctg
ggactgatactggcgctgaccctggtgggtctagtgagtctggtgagctggaggtggcgt
caacagctcaggacggcctccccagacacttcagaaggagtccagcaagagtccctggaa
aatgtctttgtaccctcctcagaaacccctcatgcctcagctcctacctggcctccgctc
aaagaagatgcagacagcgccctgccacgccacagcgtcccggtgcccgccacagaactg
ggctccaccgagctggtgaccaccaagacagctggcccagagcaatag

DBGET integrated database retrieval system