KEGG   Mus musculus (mouse): 72512
Entry
72512             CDS       T01002                                 

Gene name
Sting1, 2610307O08Rik, E, ERIS, MP, MPYS, Mita, STING, STING-beta, St, Tmem173
Definition
(RefSeq) stimulator of interferon response cGAMP interactor 1
  KO
K12654  transmembrane protein 173
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05163  Human cytomegalovirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    72512 (Sting1)
   04622 RIG-I-like receptor signaling pathway
    72512 (Sting1)
   04623 Cytosolic DNA-sensing pathway
    72512 (Sting1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    72512 (Sting1)
   05171 Coronavirus disease - COVID-19
    72512 (Sting1)
   05168 Herpes simplex virus 1 infection
    72512 (Sting1)
   05163 Human cytomegalovirus infection
    72512 (Sting1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    72512 (Sting1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    72512 (Sting1)
SSDB
Motif
Pfam: TMEM173
Other DBs
NCBI-GeneID: 72512
NCBI-ProteinID: NP_082537
MGI: 1919762
Ensembl: ENSMUSG00000024349
UniProt: Q3TBT3 A0A2R3XZC4
LinkDB
Structure
PDB: 

Position
18 B2; 18
AA seq 378 aa
MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLL
KNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMF
GLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRM
FNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYS
NSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILED
VPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEP
RLLISGMDQPLPLRTDLI
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgccatactccaacctgcatccagccatcccacggcccagaggtcaccgctccaaatat
gtagccctcatctttctggtggccagcctgatgatcctttgggtggcaaaggatccacca
aatcacactctgaagtacctagcacttcacctagcctcgcacgaacttggactactgttg
aaaaacctctgctgtctggctgaagagctgtgccatgtccagtccaggtaccagggcagc
tactggaaggctgtgcgcgcctgcctgggatgccccatccactgtatggctatgattcta
ctatcgtcttatttctatttcctccaaaacactgctgacatatacctcagttggatgttt
ggccttctggtcctctataagtccctaagcatgctcctgggccttcagagcttgactcca
gcggaagtctctgcagtctgtgaagaaaagaagttaaatgttgcccacgggctggcctgg
tcatactacattgggtacttgcggttgatcttaccagggctccaggcccggatccgaatg
ttcaatcagctacataacaacatgctcagtggtgcagggagccgaagactgtacatcctc
tttccattggactgtggggtgcctgacaacctgagtgtagttgaccccaacattcgattc
cgagatatgctgccccagcaaaacatcgaccgtgctggcatcaagaatcgggtttattcc
aacagcgtctacgagattctggagaacggacagccagcaggcgtctgtatcctggagtac
gccacccccttgcagaccctgtttgccatgtcacaggatgccaaagctggcttcagtcgg
gaggatcggcttgagcaggctaaactcttctgccggacacttgaggaaatcctggaagat
gtccccgagtctcgaaataactgccgcctcattgtctaccaagaacccacagacggaaac
agtttctcactgtctcaggaggtgctccggcacattcgtcaggaagaaaaggaggaggtt
accatgaatgcccccatgacctcagtggcacctcctccctccgtactgtcccaagagcca
agactcctcatcagtggtatggatcagcctctcccactccgcactgacctcatctga

DBGET integrated database retrieval system