KEGG   Mus musculus (mouse): 72993Help
Entry
72993             CDS       T01002                                 

Gene name
Appl1, 2900057D21Rik, 7330406P05Rik, AI585782, AW209077, BB022931, C88264, DIP13
Definition
(RefSeq) adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
  KO
K08733  DCC-interacting protein 13 alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04211  Longevity regulating pathway
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    72993 (Appl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    72993 (Appl1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    72993 (Appl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    72993 (Appl1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    72993 (Appl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 PID PH BAR PH_9
Motif
Other DBs
NCBI-GeneID: 72993
NCBI-ProteinID: NP_660256
MGI: 1920243
Ensembl: ENSMUSG00000040760
Vega: OTTMUSG00000016350
UniProt: Q8K3H0
LinkDB All DBs
Position
14; 14 A3
AA seq 707 aa AA seqDB search
MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPISQFKE
RDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMH
YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNGQLEEFLANIGTSVQNVRREM
DGDVETMQQTIEDLEVASDPLYLPDPDPTKFPINRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPGGQSRPP
TARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNP
FGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMT
ESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSGGRSESNLSS
VCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELSKQKQIEK
DLEEQSRLIAASSRPNQAGSEGQLVLSSSQSEESDLGEEGKKRESEA
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgccggggatcgacaagctgcccattgaagagaccctggaggacagtccgcagacaagg
tctttacttggtgtatttgaagaagatgctactgctatttcaaattatatgaaccaattg
tatcaagctatgcatcggatttatgatgcacagaatgaattgagtgcagcaacacacctg
acttcgaaacttttgaaagaatatgaaaaacagcgttttcctttggggggtgatgatgaa
gttatgagctctactttgcagcagttttccaaggtcatagatgagcttagttcttgtcat
gcagtactttcaactcaacttgctgatgccatgatgttccccatttcccagtttaaagaa
agagatctgaaagaaatattgacactaaaggaggtatttcaaattgctagtaatgatcat
gatgccgcaattaataggtacagtcggttgtcaaaaaagagagaaaatgacaaggtaaaa
tatgaagttacagaggatgtatatacttccaggaaaaaacaacaccagaccatgatgcat
tatttttgtgcactaaatactcttcagtacaagaagaaaatagctttgttagaacctcta
ctgggatacatgcaggctcagataagtttctttaagatgggttctgaaaatctcaatgga
caactggaagaattcttagctaacattggaacaagtgtacagaatgttcgaagagaaatg
gatggtgatgtagagaccatgcagcagacaatagaagacttggaggtagccagtgaccct
ttatatctgcctgacccggatcccaccaagtttcccatcaatcgaaatttaacccgaaag
gctggatacctaaatgctaggaataaaacaggcttggtgtcatctacctgggatagacag
ttttacttcacgcagggtggaaacttaatgagtcaagcccgtggagatgtggcaggaggc
ctagccatggacatagacaactgttcagtgatggctgtggactgtgaagacagacgatac
tgttttcagatcacttcttttgatggaaaaaaatcttcaatattgcaagcagagagtaaa
aaagaccatgaagagtggatctgtacaataaacaacatatctaaacaaatatatttgagt
gaaaatccagaggaaactgctgcacgagtgaatcagtctgctctagaagctgtcactcct
tccccatctttccagcagagacacgagagcctgcgtccaggaggacaatctcggccacca
acagctcgaaccagcagttcaggatccttgggatcagagtctacaaatttggctgccctc
tctctagattctcttgttgctccggatacaccaatacagtttgatataatttctcctgtg
tgtgaagatcagcctggccaggcaaaagcctttggtcaaggaggcaggcgtacaaatcca
tttggagaatctggaggaagcacaaaatcagaaacagaagactctattcttcatcagtta
tttattgtccgattccttggttctatggaggtaaagtcagatgaccatccagatgttgtc
tatgaaacaatgcgccagatcttagctgctcgggccatccacaacatctttcgtatgaca
gaatcacatttattagtcacttgtgactgcttgaagttaattgatccgcagacccaagtt
acaaggctcacatttccattgccgtgtgtagttctgtatgctacgcaccaggaaaataaa
cgactttttggatttgttctccggacatcaggcggaagaagtgagagtaatttgtcatca
gtctgctatatatttgaatcaaacaatgagggagaaaagatttgtgattctgttggactg
gcaaaacagatagctttgcatgctgaactggatcgtagggcatcagaaaaacaaaaagaa
atagagagagtaaaagagaaacagcagaaagagctcagcaaacagaaacagattgagaag
gacttggaagaacagagtcggttgatagctgcctccagtagaccaaaccaggctggtagt
gagggccagcttgttcttagcagtagccaatcagaggagagtgatttgggagaagaaggg
aaaaaaagagagtcggaagcataa

DBGET integrated database retrieval system