KEGG   Mus musculus (mouse): 73086Help
Entry
73086             CDS       T01002                                 

Gene name
Rps6ka5, 3110005L17Rik, 6330404E13Rik, AI854034, MSK1, MSPK1, RLPK, RLSK, S6K-alpha-5
Definition
(RefSeq) ribosomal protein S6 kinase, polypeptide 5
  KO
K04445  ribosomal protein S6 kinase alpha-5 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04713  Circadian entrainment
mmu04722  Neurotrophin signaling pathway
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    73086 (Rps6ka5)
   04668 TNF signaling pathway
    73086 (Rps6ka5)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    73086 (Rps6ka5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    73086 (Rps6ka5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    73086 (Rps6ka5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    73086 (Rps6ka5)
   05206 MicroRNAs in cancer
    73086 (Rps6ka5)
  09162 Cancer: specific types
   05219 Bladder cancer
    73086 (Rps6ka5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    73086 (Rps6ka5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     73086 (Rps6ka5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   73086 (Rps6ka5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH Pkinase_C Pkinase_fungal Haspin_kinase FTA2 RIO1 Choline_kinase SR-25
Motif
Other DBs
NCBI-GeneID: 73086
NCBI-ProteinID: NP_705815
MGI: 1920336
Ensembl: ENSMUSG00000021180
UniProt: Q8C050 Q3TUH8
LinkDB All DBs
Position
12; 12 E
AA seq 863 aa AA seqDB search
MEGEGGGSGGAGTSGDSGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYG
KVFLVRKISGHDAGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAF
QTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLE
NILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWSL
GVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSTVAKDLLQRLLMKDPKKR
LGCGPRDAEEIKEHLFFEKIKWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSP
AALPQSSERLFQGYSFVAPSILFKRNAAVIDPLQFHMGVDRPGVTNVARSAMMKDSPFYQ
HYDLDLKDKPLGEGSFSICRKCVHKKTNQAFAVKIISKRMEANTQKEITALKLCEGHPNI
VKLHEVFHDQVAASAQPPGQVVLCSLLLLALLFNRSLTRKPVTWTWLVHSTSQLPPLPPP
MPEIVLFILLSDNGQLHTFLVMELLNGGELFERIKRKKHFSETEASYIMRKLVSAVSHMH
DVGVVHRDLKPENLLFTDENDNLEIKVIDFGFARLKPPDNQPLKTPCFTLHYAAPELLTH
NGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNV
SQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVK
ATFHAFNKYKREGFCLQNVDKAPLAKRRKMKRTSTSTETRSSSSESSRSSSSQSHGKTTP
TKTLQPSNPTEGSNPDTLFQFSD
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggagggggagggcggcggcagcggcggcgcgggcaccagcggggacagcggcgacggc
ggcgagcagctccttactgtcaagcacgagctgcggaccgccaacttaacaggacacgca
gagaaggtggggattgaaaactttgagctgctgaaggtcctaggaactggagcttatggg
aaagtatttctagttcgtaaaataagcggccatgatgctggaaagctgtatgctatgaag
gttttaaaaaaggcaacaatagttcagaaggctaaaactacagagcatacaaggacagaa
cgacaggttctggagcacattagacagtcgccatttttggtgacattgcactatgctttc
cagacagagaccaagcttcatctcatcttagattatataaatggtggagaactttttact
catctttctcaaagagagcgtttcacagagcacgaagtgcagatctatgttggagagatt
gtgcttgccctggaacacctgcacaagttggggattatataccgtgacattaagcttgaa
aatattctcctggattctaacggccatgtggtgctgacagatttcggtctgagtaaggag
tttgtggccgatgaaactgaaagagcatattctttttgtggaactattgaatacatggct
ccagatattgtcagagggggtgattcgggacacgacaaggcagttgactggtggagctta
ggtgttctaatgtatgagctactaactggagcatctcctttcactgtcgatggagaaaaa
aattcccaggctgagatatctaggagaattttaaaaagtgagcctccgtatccccaggaa
atgagcacagtagctaaagacctacttcagcgtctcttgatgaaagatcccaagaagcga
ttgggatgtggcccacgggatgcagaagaaatcaaagaacatctcttctttgagaagata
aagtgggatgacttagctgccaaaaaagtgcctgcgccattcaagccggtgatccgggat
gagttagatgtgagtaacttcgctgaagagttcacagagatggaccccacctactctccc
gctgccttgccacagagctccgagcgactgtttcagggctattccttcgttgctccatct
attctcttcaagcgtaacgcagctgtcatagatcctcttcagttccatatgggagttgac
cgtcctggagtgacaaatgttgccaggagtgcaatgatgaaggactcacccttctatcaa
cactatgacctagatctgaaggacaaacctttgggagaaggaagtttttcaatttgtcgc
aagtgtgtacacaaaaaaactaaccaagcatttgctgtcaaaataatcagcaaaaggatg
gaagccaatactcagaaagaaataacagctctgaaactctgcgaaggacaccccaatatt
gtgaaactacatgaagtttttcacgatcaggtggcagcgtctgctcagcccccaggacag
gttgttctatgctctcttctactcttagctctgcttttcaacagaagtctcacacggaag
cctgtcacttggacatggctggtccatagcacctctcagctccctccattgccacctccc
atgcctgaaattgtgctatttattcttctctctgataatggacagcttcatacgtttctt
gtgatggaacttctgaatggcggagagctgttcgagcgcatcaagagaaagaagcacttc
agcgagactgaggccagctacatcatgcggaagcttgtgtcagctgtgagccacatgcac
gatgtaggagtggtgcacagagatctgaagcctgagaatctgttgttcactgatgaaaac
gacaatttggaaattaaagtgattgactttgggtttgcacgcctcaagccacctgacaat
cagcccctcaagaccccgtgcttcaccctccactacgcagcaccggagctcttgacgcac
aatggctacgatgagtcctgtgacctgtggagcttgggtgtcatcctgtatacaatgctg
tcagggcaggtgccattccagtctcatgacagaagtttaacatgcaccagtgcagtggaa
atcatgaagaaaattaaaaagggagacttctcctttgaaggagaagcgtggaagaatgta
tcccaagaggctaaagatttgattcaagggcttcttacagttgatccaaataaaaggctg
aaaatgtctggtttgagatacaatgaatggcttcaggatggcagtcagctgtcctccaat
cctctgatgactccagacattctgggatcgtcaggagcagctgtgcacacctgtgtgaaa
gcaacctttcatgcctttaacaagtataagagagaaggattttgcctgcagaatgtggat
aaggcccctttggctaagaggaggaaaatgaagaggaccagcaccagcacagagactcgc
agcagctccagcgagagctcccgctcctcctcctcccagtcccacggcaagacaacgcct
accaagacgctgcagcccagcaatcccaccgaaggcagtaacccagacaccctcttccag
ttctcagactga

DBGET integrated database retrieval system