KEGG   Mus musculus (mouse): 74256Help
Entry
74256             CDS       T01002                                 

Gene name
Cyld, 2010013M14Rik, 2900009M21Rik, C130039D01Rik, CDMT, CYLD1, EAC, mKIAA0849
Definition
(RefSeq) CYLD lysine 63 deubiquitinase
  KO
K08601  ubiquitin carboxyl-terminal hydrolase CYLD [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    74256 (Cyld)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    74256 (Cyld)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    74256 (Cyld)
   04625 C-type lectin receptor signaling pathway
    74256 (Cyld)
  09158 Development
   04380 Osteoclast differentiation
    74256 (Cyld)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    74256 (Cyld)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    74256 (Cyld)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     74256 (Cyld)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C67
   74256 (Cyld)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    74256 (Cyld)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CYLD_phos_site CAP_GLY UCH
Motif
Other DBs
NCBI-GeneID: 74256
NCBI-ProteinID: NP_001121643
MGI: 1921506
Ensembl: ENSMUSG00000036712
Vega: OTTMUSG00000061528
UniProt: Q80TQ2
LinkDB All DBs
Position
8; 8 C3
AA seq 952 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRV
PSTKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERLSLFRNRLRLS
KGLQVDVGSPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDNGLESDFAGPGDTMQVEPPPLEINSRVSLKV
GESTESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPDSVTQERRPPKLAFMSRGVGDKGSSSHNKPKVTGSTSDPGSRNRSELFYTLNGSSV
DSQQSKSKNPWYIDEVAEDPAKSLTEMSSDFGHSSPPPQPPSMNSLSSENRFHSLPFSLT
KMPNTNGSMAHSPLSLSVQSVMGELNSTPVQESPPLPISSGNAHGLEVGSLAEVKENPPF
YGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSR
FASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLD
STLFCLFAFSSALDTVLLRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRK
ILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEK
VGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDT
PRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDL
PDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIP
QVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcctgtggagccaagagaaagttacttcaccctactgggaagaacggatt
ttttatctgcttcttcaagaatgcagtgtaacagacaaacaaactcagaagctgctgaaa
gtacccaaagggagtataggacagtacatccaagaccgttctgtggggcattcaagagtt
ccttccacaaaaggcaagaaaaatcagattggattaaaaatcttggagcaaccgcatgca
gttctgtttgttgatgaaaaggatgttgtagaaataaatgaaaaattcacagagttactg
ttggcaattaccaactgtgaggagaggctcagcctatttagaaacagactccgactaagt
aaaggcctccaggtagacgtgggcagtcctgtgaaagtacagctgcgatctggggaagag
aaatttccaggagttgtacgcttcagaggacctttattagcggagaggacggtgtcgggg
attttctttggagtagaattattggaagaaggtcgtggtcaaggtttcacggatggggta
tatcaagggaagcagcttttccagtgtgatgaggactgtggcgtgtttgttgcattggac
aaactagaacttatagaagatgatgacaatggattggaaagtgattttgcaggcccagga
gatacaatgcaggttgaacctccccctttggaaataaactccagagtttctttgaaggtt
ggagaaagtacagaatctggaacagtaatattctgtgatgttttaccaggaaaagagagt
ctaggatattttgttggtgtggacatggataaccctattggcaactgggatggaaggttt
gatggagtacagctctgtagttttgcaagtgttgaaagtacaattctcctgcacatcaat
gacatcatcccagatagcgtgacacaggaaaggaggcctcccaaacttgcctttatgtca
agaggtgtaggtgacaaaggttcatctagtcataataaaccaaaggttacaggatctacc
tcagaccctggaagtagaaacagatctgaattattttataccttaaatgggtcatctgtt
gactcacaacaatccaagtccaaaaatccatggtacattgatgaagttgcagaagaccct
gcaaagtcacttacagagatgtcttcggacttcggacattcatctcctccaccgcagcct
ccttccatgaactccttgtctagcgagaacagattccactccttacccttcagcctgaca
aagatgcccaatactaatggcagcatggctcatagtccactctctctgtcagtgcagtct
gtgatgggggagctgaacagcacacctgtccaggagagtccacccttgcccatctcttct
gggaatgcacacgggctagaggtgggctcactggctgaagtaaaagagaaccccccgttc
tatggggttatccgttggattggccagccaccagggctcagtgacgtgctagctggactg
gaactggaagatgaatgcgcaggctgtacagatggaactttcaggggcacgcggtatttc
acgtgtgccctgaagaaggcactgtttgtgaaactgaagagctgcagaccggactctagg
tttgcatccttgcagcctgtttccaatcaaattgaaaggtgtaactctttagcatttggg
ggctatttaagtgaagtagtagaagaaaatactccacctaaaatggaaaaggaaggttta
gagataatgattggaaagaagaaaggcatccagggccattacaattcttgttacttagac
tcaactttattctgcttatttgcttttagttctgccctggacactgtgttacttagaccc
aaagagaagaatgatatagagtattacagtgagactcaggagctactgaggacagagata
gtcaatcctctgagaatatatggatatgtgtgtgccacaaagattatgaaactgaggaaa
atacttgaaaaagttgaggctgcatcaggttttacctctgaagaaaaagatcctgaagaa
ttcttaaatatcctgtttcatgatattttaagggttgaaccattgttaaaaataagatca
gcaggtcaaaaagttcaagactgtaacttctatcaaatttttatggaaaaaaatgagaaa
gttggagtacccacaattcagcagttattagaatggtcttttatcaacagcaacctgaaa
tttgcagaggcaccatcatgcttgattatccagatgcctcggtttggaaaagactttaaa
ctatttaaaaaaatttttccttccctggaattaaatataacagatttacttgaagacact
cccaggcagtgccgcatctgtggaggacttgcgatgtacgagtgcagggagtgctatgac
gatccggacatctcagctgggaagatcaagcagttctgtaagacctgcagcactcaggtt
caccttcatcccaggaggttgaatcattcttatcatccagtatcacttcccaaagacttg
cctgactgggactggagacacggctgcatcccctgtcagaagatggagttatttgctgtt
ctctgcatagaaacgagccactatgttgcttttgtgaagtatgggaaggatgactctgcc
tggcttttctttgacagcatggcggatcgagatggtggtcagaatggcttcaacattcca
caagtgacgccctgcccagaagtgggagagtacttgaagatgtctctggaggacctgcac
tctttggattccagaaggattcaaggctgtgcgcgcagacttctttgcgatgcatacatg
tgcatgtaccagagtccaaccatgagcctgtacaaataa

DBGET integrated database retrieval system