KEGG   Mus musculus (mouse): 75590Help
Entry
75590             CDS       T01002                                 

Gene name
Dusp9, Dusp4, Mpk4, Pyst3
Definition
(RefSeq) dual specificity phosphatase 9
  KO
K18498  dual specificity phosphatase 9 [EC:3.1.3.16 3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    75590 (Dusp9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    75590 (Dusp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    75590 (Dusp9)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     75590 (Dusp9)
    3.1.3.48  protein-tyrosine-phosphatase
     75590 (Dusp9)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    75590 (Dusp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Init_tRNA_PT Y_phosphatase PTPlike_phytase XRN_M
Motif
Other DBs
NCBI-GeneID: 75590
NCBI-ProteinID: NP_083628
MGI: 2387107
Ensembl: ENSMUSG00000031383
Vega: OTTMUSG00000017648
UniProt: Q7TNL7
LinkDB All DBs
Position
X; X A7.3
AA seq 452 aa AA seqDB search
MESLSRSCLWLRQELSSPRPQLLLLDCRSRELYESARICGALSVALPSLMLRRLRRGSMS
VRSLLPGPPLQPPPPAPVLLYDQGSSGQCHREAAEAEAKAEPKAEAEAEPKAEAEAEPKA
EAENEAEAKAEAKAEAKAEAKAEAKAEAKAEAKAEAKAEAKAEAKEEWDADSVLGVLLQK
LREEGYPAYYLQGGFSKFQAECPHLCETSFSGRAGSGLGSMSSPVPVVGLGGLCLSSDFS
DAESEADRDTLSCGLDSENTTSPPAGLLPPFPVQILPNLYLGSARDSANLESLAKLGIRY
ILNVTPNLPNLFEKNGDFHYKQIPISDHWSQNLSQFFPEAIAFIDEALSQNCGVLVHCLA
GVSRSVTVTVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLGGKRSG
GRGSGGPESTVSDPPSFFTTPTSDGVFELDPT
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggagagtctgagtcggtcatgcctgtggctgcgtcaggagctgtcgtccccgcgccca
cagcttctgctgctggactgccgcagccgggagctgtatgagtcggcgcgcatctgcggg
gcgctgagcgtggccctgccctcgctgatgctgcgccgcctgcggagggggagcatgtcg
gtgcggtcgctcttgcctgggccaccactgcagcctcccccaccggcccctgtgctcctg
tacgaccagggtagcagtggccagtgccatcgtgaagcagcggaggctgaagcgaaggcc
gaacctaaggctgaagcggaggccgaacctaaggctgaagcggaggccgaacctaaggct
gaagcggagaacgaagcggaggctaaagcggaggccaaagcggaggccaaagcggaggct
aaagcggaggccaaagcggaggccaaagcggaggccaaagcggaggctaaagcggaggcc
aaagcggaggccaaagaagagtgggatgctgactcggtgctgggcgtcctgctccagaag
ctgcgggaagaaggctacccagcatactacctacagggtggcttcagcaagttccaggcc
gagtgtcctcacctgtgtgaaaccagcttcagtggtcgtgccggctcaggcctgggctca
atgtctagcccagtgcctgtggtggggctaggtggcctgtgcttgagctctgatttctct
gatgcagagtctgaggctgaccgtgacaccttgagctgtggcctagattctgagaacacc
acatcccctccagctgggctgctaccacccttcccagtccagatcctgcccaatctctac
ctaggcagtgctcgagattcagccaatttggagagcctggccaagcttggcatccgctat
atcctcaatgtcacccccaaccttcctaacctctttgagaagaatggtgacttccactac
aagcagatccccatctctgaccattggagccagaatctgtcccagttctttccggaggcc
attgcattcattgatgaggccttgtcgcagaactgtggggtgctcgtccactgtctggca
ggggtcagccgctctgtcactgtcaccgtggcctacctcatgcagaagcttcacctctca
ctcaacgatgcctacgacttggtcaagcggaagaagtctaacatctcacctaacttcaac
tttatggggcagctgctagactttgaacgcagcctgcgcctgggggggaagcgctccggg
gggcggggcagtgggggaccagagtccaccgtctcagacccaccttccttctttactacc
cctaccagtgatggggtctttgagctggaccccacataa

DBGET integrated database retrieval system