KEGG   Mus musculus (mouse): 76051Help
Entry
76051             CDS       T01002                                 

Gene name
Ganc, 5830445O15Rik, 9330160A12, mFLJ00088
Definition
(RefSeq) glucosidase, alpha; neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    76051 (Ganc)
   00500 Starch and sucrose metabolism
    76051 (Ganc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     76051 (Ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 76051
NCBI-ProteinID: NP_766260
MGI: 1923301
Ensembl: ENSMUSG00000062646
Vega: OTTMUSG00000015382
UniProt: Q8BVW0 A2AQJ8
LinkDB All DBs
Position
2; 2 E5
AA seq 913 aa AA seqDB search
MEAAEKEEISVEDEAVDKTIFKDCGKIAFYRRQKQQLTKTTTYQALLGSVDTEQDSTRFQ
IISEATKIPLVAEVYGIEKDIFRLKINEETPLKPRYEVPDVINSKLGTVRLVCSGDTGSL
ILTNRKGDLKCHVSANPFKIDLLSKNEAVISINSLGQLYFEHLQVPHKQRATKGNGQNTP
AATSQENQEDLGLWEEKFGKFVDVKANGPSSVGLDFSLHGFEHLYGIPQHAESHQLKNTR
DGDAYRLYNLDVYGYQVHDKMGIYGSVPYLLAHKQGRTVGIFWLNASETLVEINTEPAVE
YTLTQMGPAAAKQKVRCRTDVHWMSESGIIDVFLLTGPTPADVFKQYSYITGTQAMPPLF
SLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEDKKYFTWDKKRFANPKRM
QELLRSKKRKLVVISDPHIKVDPDYTVYAQAKEQGFFVKNPEGGDFEGVCWPGLSSYLDF
TNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPELTMHKSAVHYGDWEHRELH
NIYGFYQQMATAEGLIQRSKGKERPFVLSRSFFAGSQKYGAVWTGDNKAEWSYLKISIPM
LLTLSVSGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGEE
YTQLIREAIRQRYALLPYLYSLFYHTHVSSQPVMRPLWVEYPDDLETFAVEDEYMLGSAL
LVHPVTDPQTATIDVFLPGSDEVWYDSKTFAYWKGGCTVKIPVTLDTIPVFQRGGSVVPV
KTTVGTSTGWMADSPYELRVALSTQGSAVGELYLDDGHSFQYLHQNQFLYRKFLFCSSVL
TNRCANEKGHYPSKCIVEQILVLGLKKKPSSVTTHLSDGRAQPAAFTYCAETSALRLEKL
SLRIGEDWEVRVG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgagaaagaggaaatcagtgttgaagatgaagcagtggataaaactatt
ttcaaagactgtggcaagattgcattctacaggcggcagaaacagcagctcaccaagact
accacctaccaggctttgctaggctcagtcgacacagaacaggacagcaccaggttccaa
atcatcagtgaagcaactaagattcctctcgtggctgaagtttatggtatagagaaagac
attttcagacttaagatcaatgaagagactccactgaaaccaaggtatgaagttcctgac
gtcatcaacagcaagctaggaactgtcaggctggtctgctcaggggacacaggcagccta
atactgacaaatagaaaaggagatctgaaatgtcacgtctcagcaaacccattcaagatc
gatttgctgtcgaagaacgaggctgtgatcagcatcaactccctgggccagttatacttt
gagcacctacaggttcctcacaagcagagagctaccaaaggaaatgggcaaaatacacca
gctgccacctctcaggaaaatcaagaggacctgggcctgtgggaagaaaaatttggaaaa
tttgtggatgtcaaagctaatggcccttcctctgttggtttggatttctctcttcatgga
tttgaacatctctatggtattcctcaacatgcagagtcacatcaacttaaaaataccaga
gatggagatgcataccgtctttataatctggacgtctatggataccaagtgcatgacaaa
atgggcatatatggttcagtgccttatctcctggcccacaaacagggcaggactgtaggc
attttctggctgaatgcttcagaaacactcgtggagatcaacacagagccagcagttgag
tacacactgacccagatgggcccagcagctgccaaacaaaaggtcaggtgccgaactgat
gtgcactggatgtcagagagtgggatcattgacgtttttctgctgacaggacctacacct
gctgacgtcttcaaacagtactcatatatcacaggcacacaagccatgccccctcttttt
tccttggggtaccaccagtgtcgctggaactatgaagatgaacaggatgtgaaggcagta
gatgcagggtttgatgagcatgacattccatatgatgtcatgtggctggacatagagcac
acggaggacaagaagtacttcacctgggacaaaaagagatttgcaaaccccaaaaggatg
caagagctgctcaggagcaaaaaacgcaagcttgtggttatcagtgacccccacatcaag
gtggatcctgactacacagtctatgctcaagccaaagaacagggcttctttgtgaagaat
ccagagggtggcgacttcgaaggagtatgttggcctggtctctcgtcttacctggatttc
accaaccccaaggtcagagagtggtattccagcctttttgcttttcctgtttatcaggga
tctacggacatccttttcctatggaatgacatgaatgagccctcagtcttcagagggcct
gagctaaccatgcacaagagtgctgttcattatggcgactgggaacacagagaacttcac
aacatctacggattttatcagcaaatggctactgcagaaggattgatacaacgatctaag
gggaaggagaggccctttgttctttcacgttccttctttgccggatcacaaaagtatggt
gcagtgtggacaggagacaacaaagcggaatggagctatctgaaaatctccatcccgatg
ttactcactctcagtgtctcgggaatctccttctgtggagctgatgtgggtggcttcatt
ggcaatcctgaggcagagctgcttgtgcgttggtaccaggctggagcttaccagcccttc
ttccgaggccatgccaccatgaacaccaagcgacgagaaccctggctgtttggggaagaa
tacactcagctgatccgggaagccatcaggcagcgctacgccctcctgccctatctgtat
tctctgttctaccacacgcacgtgtcttctcagcccgtcatgaggcctctgtgggtcgaa
tatcctgatgacttagagacttttgctgtggaagatgaatacatgctgggaagcgcttta
ttggttcatccagttacagacccacagaccgccacgattgacgtgttcctgccagggtca
gatgaggtctggtacgactctaagacatttgcatattggaaaggagggtgtactgtgaag
attccagtaaccttggatactatcccagtgtttcagcgaggtggaagtgtggtaccagta
aagaccactgtgggaacgtccactggctggatggctgactccccttatgagctccgggtt
gccctaagcactcagggttctgctgtgggagagctgtatcttgatgacggccattcattc
cagtacctccaccagaaccagttcttataccgcaagttcttattctgctccagtgttctg
accaacaggtgtgccaatgagaagggtcattaccccagcaagtgcattgtggagcagatc
ttggtcttaggccttaagaagaagccatcttctgtgactacccacttgtctgatggtaga
gctcagcctgcagcttttacatattgtgccgaaacatctgccctgcgtctggagaagctg
tctctgcgcattggtgaggactgggaagtccgtgtgggctga

DBGET integrated database retrieval system