KEGG   Mus musculus (mouse): 77125
Entry
77125             CDS       T01002                                 

Gene name
Il33, 9230117N10Rik, Il-, Il-33, Il1f, Il1f11, NF-H, NF-HEV
Definition
(RefSeq) interleukin 33
  KO
K12967  interleukin 33
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04217  Necroptosis
mmu04623  Cytosolic DNA-sensing pathway
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    77125 (Il33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    77125 (Il33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    77125 (Il33)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    77125 (Il33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    77125 (Il33)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   77125 (Il33)
SSDB
Motif
Pfam: IL33
Other DBs
NCBI-GeneID: 77125
NCBI-ProteinID: NP_001158196
MGI: 1924375
Ensembl: ENSMUSG00000024810
Vega: OTTMUSG00000028342
UniProt: Q8BVZ5
LinkDB
Structure
PDB: 
5VI4

Position
19; 19 C1
AA seq 266 aa
MRPRMKYSNSKISPAKFSSTAGEALVPPCKIRRSQQKTKEFCHVYCMRLRSGLTIRKETS
YFRKEPTKRYSLKSGTKHEENFSAYPRDSRKRSLLGSIQAFAASVDTLSIQGTSLLTQSP
ASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLM
VNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIG
VKDNQLALVEEKDESCNNIMFKLSKI
NT seq 801 nt   +upstreamnt  +downstreamnt
atgagacctagaatgaagtattccaactccaagatttccccggcaaagttcagcagcacc
gcaggcgaagccctggtcccgccttgcaaaataagaagatcccaacagaagaccaaagaa
ttctgccatgtctactgcatgagactccgttctggcctcaccataagaaaggagactagt
tattttaggaaagaacccacgaaaagatattcactaaaatcgggtaccaagcatgaagag
aacttctctgcctatccacgggattctaggaagagatccttgcttggcagtatccaagca
tttgctgcgtctgttgacacattgagcatccaaggaacttcacttttaacacagtctcct
gcctccctgagtacatacaatgaccaatctgttagttttgttttggagaatggatgttat
gtgatcaatgttgacgactctggaaaagaccaagagcaagaccaggtgctactacgctac
tatgagtctccctgtcctgcaagtcaatcaggcgacggtgtggatgggaagaagctgatg
gtgaacatgagtcccatcaaagacacagacatctggctgcatgccaacgacaaggactac
tccgtggagcttcaaaggggtgacgtctcgcctccggaacaggccttcttcgtccttcac
aaaaagtcctcggactttgtttcatttgaatgcaagaatcttcctggcacttacatagga
gtaaaagataaccagctggctctagtggaggagaaagatgagagctgcaacaatattatg
tttaagctctcgaaaatctaa

DBGET integrated database retrieval system