KEGG   Mus musculus (mouse): 83564
Entry
83564             CDS       T01002                                 

Gene name
Nlrp4c, Na, Nalp-alpha, Nalp4c, Rn, Rnh2
Definition
(RefSeq) NLR family, pyrin domain containing 4C
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    83564 (Nlrp4c)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    83564 (Nlrp4c)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    83564 (Nlrp4c)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   83564 (Nlrp4c)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 RNA_helicase LRR_4 CAF1 LacAB_rpiB AAA_30 PIN_12
Other DBs
NCBI-GeneID: 83564
NCBI-ProteinID: NP_113566
MGI: 1890518
Ensembl: ENSMUSG00000034690
Vega: OTTMUSG00000029734
UniProt: Q3TKR3
LinkDB
Position
7; 7 A1
AA seq 982 aa
MASFFSDFGLMWYLEELNKKEFMKFKEFLKQEILQLRLKQISWTEVKKASREDLANLLLK
HYEEKKAWDMTFKIFQKMNRKDLMERAGREIAGHSKLYQAHLKKKLTHDYARKFNIKVQD
FSKQKFTQDDYDRFENFLISKVTAKKPHMVFLQGAAGIGKSLMLTKLMLAWSEGMVFQNK
FSYIFYFCCQDVKKMKRASLAELISKEWPKTSAPIEDILSQPEKLLFVIDNLEVMECDMS
ERESELCDTCTEKQPVRILLSSLLRRKMLPKSSFLISATPETFEKMEGRVECTNVKIVTG
FNESNIKMYFRSLFQDKTKTQEIFSLVKENQQLFTVCQVPVLCWMVATCLKKEIEKGRDL
VSVCRRTTSLYTTHIFNLFIPQSAQYPSKESQAQLQSLCSLAAEGMWTDTFVFGEEALRR
NGIMDSDIPTLLDVRILEKSKKSEKSYIFLHPSIQEVCAAIFYLLKSHMDHPSQDVKSIE
ALIFTFLKKVKVQWIFFGSFIFGLLHESEQKKLEAFFGHQLSQEIKRQLYQCLETISGNE
ELQEQVDGMKLFYCLFEMDDEAFLAQAMNCMEQINFVAKDYSDVIVAAHCLQHCSTLKKL
SLSTQNVLSEGQEHSYTEKLLMCWHHMCSVLISSKDIYILQVKNTNLNETASLVLYSHLM
YPSCTLKALVVNNVTFLCDNRLFFELIQNQCLQHLDLNLTFLSHGDVKLLCDVLSQEECN
IEKLMVAACNLSPDDCKVFASVLISSKMLKHLNLSSNNLDKGISSLSKALCHPDCVLKNL
VLVNCSLSEQCWDYLSEVLRRNKTLNHLDISSNDLKDEGLKVLCGALSLPDSVLKSLSVR
YCLITTSGCQDLAEVLRKNQNLRNLQVSNNKIEDAGVKLLCDAIKHPNCHLENIGLEACA
LTGACCEDLASAFTHCKTLWGINLQENALDHSGLIVLFEALKQQQCTLHVLGLRITDFDK
ETQELLMAEEEKNPHLSILSSV
NT seq 2949 nt   +upstreamnt  +downstreamnt
atggcttcttttttttctgattttggccttatgtggtacttagaagagctaaacaagaaa
gaattcatgaagtttaaggaattcctcaaacaggagattttgcagttgagactgaaacag
atttcttggaccgaagtgaagaaggcatctcgtgaagaccttgccaacttactgttgaaa
cattatgaggagaagaaagcctgggatatgaccttcaaaatcttccagaagatgaatagg
aaggatctcatggagagggcaggaagagagattgctggacactcaaagttatatcaagct
catttgaagaagaagctgacccatgattatgccagaaagtttaacatcaaagttcaagat
ttctctaagcagaaatttacccaggatgactatgatcgttttgagaactttcttatatca
aaggtgactgcaaagaaaccacacatggtgttcctgcaaggagcagcgggaattggcaag
tcattgatgttgacaaaattaatgcttgcctggtcagaaggcatggtgtttcagaacaaa
ttctcctatatcttctacttctgctgtcaagatgtgaagaagatgaagagagcaagcctg
gcagaattgatctccaaagagtggcccaaaacctcagctcccatagaggatatcctatcc
caaccggagaaactcttatttgtcatcgacaacttggaagtgatggaatgtgatatgtct
gaacgggagtcggagctgtgtgatacctgcacggagaagcagccagtgcgtatcctgctg
agcagtttgctcaggaggaagatgctccccaaatcctctttcctcatctctgctacccca
gagacttttgagaaaatggagggcagggttgagtgcacaaatgtgaaaatagtaacagga
ttcaatgagagcaatattaagatgtatttccgcagcttgttccaagataagaccaaaaca
caggaaatcttcagtttggtgaaagaaaaccagcagctgttcactgtatgtcaggtccct
gtgctctgctggatggtggccacttgtctaaaaaaagagatagagaagggaagagacctg
gtctctgtctgccgacgtaccacttccctgtataccactcacatcttcaatttgttcatt
ccccaaagtgcccaatatccaagtaaggaaagccaagctcagcttcagagcttgtgttct
ctggccgctgagggtatgtggactgacacatttgtgtttggtgaggaggctctcagaaga
aatgggatcatggactccgacatccccacactgctggacgtaaggatccttgagaagagc
aagaaatctgaaaaatcttacattttcctccacccgtctatccaggaggtctgtgcagcc
atcttttatctgctaaagagccacatggaccaccctagccaggatgttaaaagtatagag
gcactcatatttacatttctaaagaaagtcaaagtacagtggattttttttggctctttc
atctttggccttttacatgaatcagaacaaaaaaagctagaggcattttttggccaccag
ttgtcccaggaaataaaacgtcagttgtatcagtgcctggaaaccataagtggcaacgaa
gagcttcaagaacaggtagatggcatgaagctgttttactgtctgtttgagatggacgat
gaagccttcttagcacaagcaatgaactgtatggaacagattaactttgtggctaaggat
tattctgatgttattgttgctgcccactgcttacaacactgttctacactgaagaaacta
tccttgtcaacccagaatgtcctgagtgaaggtcaagaacacagctatacggaaaagcta
ctcatgtgttggcatcatatgtgctctgtgctcataagcagtaaggacatctacatactc
caagtgaaaaacactaatctcaatgaaacagcctctttggtgttatatagtcatctgatg
taccccagctgcacccttaaagcacttgtggtaaataatgtgaccttcctatgtgataac
cgcctgttctttgagttgattcagaaccagtgtttgcagcacttggacctcaacctcaca
ttcctgtcccatggtgatgtgaaactgttgtgtgatgtcttgagccaggaagagtgcaac
atagaaaagctgatggtagcagcctgtaacctttcaccagatgactgcaaggtctttgcc
tccgttctgatcagcagcaagatgttaaagcatcttaatttgtcatctaacaacttggac
aaagggatatcctctctgtccaaggctttgtgccacccagactgcgttctgaagaacttg
gtgttagtcaactgctccctcagtgagcaatgttgggactacctttcggaagttcttagg
cggaacaaaacactgaaccacctagacatcagctccaatgacctgaaggatgaagggctg
aaggttctctgtggggctctgagtctcccagacagtgtcctgaagtcactaagtgtaaga
tattgtctcatcaccactagtggttgccaggacctggctgaagtcttgaggaagaaccag
aacctgaggaacctacaggtttcaaacaataaaatagaagatgctggtgtgaagctcctg
tgtgatgctataaaacatcccaactgccacttagagaatattggattggaagcctgcgca
ctaactggtgcctgctgtgaggaccttgcttctgcttttacccactgtaagaccctgtgg
ggaatcaacctgcaggagaacgccttggaccacagtggattgattgtactgtttgaggct
ctgaaacagcaacagtgtaccctgcatgtacttggacttcgaattactgactttgataag
gaaacccaggagctcctgatggctgaggaagagaaaaacccacacttgagcatcctaagc
agtgtgtaa

DBGET integrated database retrieval system