KEGG   Mus musculus (mouse): 93687
Entry
93687             CDS       T01002                                 

Gene name
Csnk1a1, 2610208K14Rik, 4632404G05Rik, 5430427P18Rik, CK1a, Csnk1a
Definition
(RefSeq) casein kinase 1, alpha 1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    93687 (Csnk1a1)
   04340 Hedgehog signaling pathway
    93687 (Csnk1a1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    93687 (Csnk1a1)
   05226 Gastric cancer
    93687 (Csnk1a1)
   05224 Breast cancer
    93687 (Csnk1a1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    93687 (Csnk1a1)
   05022 Pathways of neurodegeneration - multiple diseases
    93687 (Csnk1a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    93687 (Csnk1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    93687 (Csnk1a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     93687 (Csnk1a1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   93687 (Csnk1a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 93687
NCBI-ProteinID: NP_001344427
MGI: 1934950
Ensembl: ENSMUSG00000024576
Vega: OTTMUSG00000035876
LinkDB
Position
18; 18 E1
AA seq 365 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggtggaaaatacaaactggtg
cggaagatcggatctggctctttcggggacatttatctagcgatcaacatcaccaatggc
gaggaagtggcagtgaaactagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatggg
caagaaaaagactataatgtactagtcatggatctcctgggacccagccttgaagacctc
ttcaacttctgttcaaggaggttcactatgaagaccgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtccttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaacctcactggcactgcccgatacgccagcatcaatgca
catcttggtattgagcagagtcgccgagatgacatggaatctttaggatatgttttgatg
tattttaatagaaccagtctgccgtggcaaggactgaaggctgcaacaaagaaacaaaaa
tatgaaaagattagtgaaaagaagatgtccactcctgttgaggtgttgtgtaaggggttt
cctgcagaatttgccatgtacttaaattactgtcgtgggctgcgctttgaggaagctccg
gattacatgtatctgaggcagctattccgcatccttttcaggaccctgaaccaccaatat
gactacacatttgattggacgatgttaaagcagaaagcagcccagcaggcagcctcttcc
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtttctaa

DBGET integrated database retrieval system