KEGG   Mus musculus (mouse): 94176Help
Entry
94176             CDS       T01002                                 

Gene name
Dock2, AI662014, AW122239, CED-5, Hch, MBC
Definition
(RefSeq) dedicator of cyto-kinesis 2
  KO
K12367  dedicator of cytokinesis protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    94176 (Dock2)
   04062 Chemokine signaling pathway
    94176 (Dock2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    94176 (Dock2)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    94176 (Dock2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK_N DHR-2 DOCK-C2 SH3_1 SH3_9 SH3_2 DUF1539
Motif
Other DBs
NCBI-GeneID: 94176
NCBI-ProteinID: NP_203538
MGI: 2149010
Ensembl: ENSMUSG00000020143
Vega: OTTMUSG00000005408
UniProt: Q8C3J5 Q6A0A3
LinkDB All DBs
Position
11; 11 A4
AA seq 1828 aa AA seqDB search
MAPWRKTDKERHGVAIYNFQGSEAQHLTLQIGDVVRIQETCGDWYRGYLIKHKLSQGIFP
TSFIHLKEVTVEKRRNIENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSM
MYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRDEDGNILDPDKTSV
ISLFHAHEEATYKITERIKEEMSKDQPDYGVYSRISSSPTHSLYVFVRNFVCRIGEDAEL
FMSLYDPHKQTVISENYLVRWGSKGFPKEIEMLNNLKVVFTDLGNKDLNRDKIFLICQIV
RIGKMDLKDINAKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVSAENDFL
HSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG
DVRNDIYITLLQGDFDKYTKTTQRNVEVIMCVCTEDGKVLPNAICVGAGDKAMNEYHSVV
YYQVKQPRWMETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGT
TLHDGYHELVVLKGDSKKMEDASAYLTLPSYRHPVENKGATLSRSSSSVGGLSVSSRDVF
SISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEKLKIVDGEEVVKFLQDTLDALFNIM
MEHSQSNEYDILVFDALIYIIGLIADRKFQHFNTVLEAYIQQHFSATLAYKKLMTVLKTY
LDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLFSQLYEGKEQMEFEESMRRLFESINNL
MKSQYKTTILLQVAALKYIPSVLHDVETVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMN
EIVQSNLFKKQECRDILLPVITKELKELLEQRDDGQHQAEKKHCVELLNSILEVLSCQDA
AFTYDHIQEIMVQLLRTVNRTVITMGRDHALISHFVACMTAILDQMGDQHYSFYIETFQT
SSDLVDFLMETFIMFKDLIGKNVYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTSF
EFQLWNNYFHLAVAFITQDSLQLEQFTHAKYNKILNKYGDMRRLIGFSIRDMWYKLGQNK
ICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRTGAFKKFENEIILKLDHEVE
GGRGDEQYMQLLESILMECTAEHPTIAKSVENFVSLVKGLLEKLLDYRGVMTDESKDNRM
SCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCENYTEAAYTLLLHTWLLKWSDEQCASQ
VMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQN
LTQQAKFYENIMKILRTKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLLSQ
FPNAEKMNTTSAPGDDVRNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQK
FHYSRPVRRGKVDPENEFASMWIERTSFLTAYKLPGILRWFEVVHMSQTTISPLENAIET
MSTVNEKILMMINQYQSDESLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYSREHPE
DQDKLSHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVRE
MPDFEDRRVGRPRSMLRSYRQMSVISLASMHSDCSTPSKVPAESFDLESAPPKTPKVEEE
PISPGSTLPEVKLRRSKKRTKRSSVVFADEKAATESDLKRLSRKQEFMSDTNLSEHAAIP
ARVSILSQMSFASQSMPTIPALTLSVAGVPGLDEANTSPRLSQTFFQVSDGDKKTLKKKK
VNQFFKTMLASKSSEESKQIPDFLSTNM
NT seq 5487 nt NT seq  +upstreamnt  +downstreamnt
atggccccctggcgcaaaactgacaaggagcgtcacggagtggctatctacaacttccaa
ggcagtgaagcccagcatctcacgctacagattggcgatgtggtacgaatacaggagacc
tgtggagactggtacagagggtacctcataaagcataaactgtcacagggcattttccct
acatcctttatccatctcaaggaagtgacagtggagaagagaaggaacatagagaacatc
attcctgcagaaatccctctggcacaagaagtgacaaccacgctctgggagtggggaagc
atctggaagcagctctatgtggccagcaaaaaggaacgcttcctccaagtgcagtccatg
atgtacgacctgatggaatggcgctctcagctcctctcaggaacgctacccaaggatgag
ctgaaggaactgaagcagaaagtcacatcgaagatcgactatggcaacaaaatccttgag
ctcgatctcattgtcagagatgaagatggaaacatactggaccctgataagaccagcgtc
atcagcttgttccatgctcacgaggaggcaacttacaaaatcacagagcgcatcaaagaa
gaaatgtcaaaagaccagccagattatggggtttattctcggatctcctcatcccccacc
cacagcctctacgtctttgtgagaaactttgtgtgccgaattggggaggatgctgagctc
ttcatgtctctctatgaccctcacaagcaaacggtcatcagtgagaactatctggtgcga
tggggcagcaaaggattcccaaaggaaattgagatgctcaataacctgaaggtagtcttc
acggatcttggaaataaagacctcaacagggataagattttcttgatctgtcaaatagtc
cgaattgggaagatggatcttaaggacattaatgccaagaagtgcacccaggggctgagg
agaccttttggggtggcagttatggacatcaccgacatcatcaagggcaaggcagagagc
gacgaagagaagcaacattttattccatttcacccggtctcagctgagaacgatttcctt
cacagccttctgggcaaagtcatagcttccaagggagacagtggagggcaaggcctttgg
gtgaccatgaagatgctggtgggggacatcattcagatccgtaaagactacccacacttg
gtggacaggaccactgtggtagcccgaaagctgggcttcccagagatcatcatgccaggg
gatgtcaggaacgacatctacatcactctcttacaaggtgactttgacaagtacaccaag
accacacagcggaacgtggaagtgatcatgtgtgtgtgcacagaggatggcaaagtgcta
cctaatgcaatttgtgtgggagcgggggataaggccatgaacgagtaccactcagtcgtc
tactaccaagtcaaacagccccgatggatggaaacagtcaaggtggctgtccctattgaa
gatatgcagaggatccatttgaggttcatgtttcgacaccgctcatcactagaatctaaa
gataaaggagaaaagaactttgccatgtcctacgtgaaactcatgaaagaagatggaacc
actctgcatgatggataccacgagttggtggttctcaagggagacagcaagaaaatggaa
gatgccagcgcttacctgacacttccttcttatcgacaccccgtggaaaacaagggagct
acgctgagccggagctccagcagtgttgggggcctttctgtcagctcccgggatgtgttc
tccatttccacgctagtgtgctccacaaagctgacccagaatgtgggtttgcttggcttg
ctgaagtggcgtatgaagccacaactgctccaggagaatctagagaagttgaagattgtg
gatggcgaggaagtagtgaagttcctccaggacactctggatgccctcttcaacatcatg
atggaacactctcagagtaacgagtatgacatcctcgtctttgatgctttgatctatata
ataggactcattgcagaccggaaattccagcattttaacaccgtattggaggcttacatc
caacagcatttcagtgctaccttggcctacaagaaactgatgacggtgctgaagacttac
ttggatacctccagcaggggggagcagtgcgagcccatcctcagaacgctcaaagcctta
gaatacgtgttcaagttcattgttcggtcgaggacattattctcacagctttacgaaggc
aaagagcagatggagtttgaagaatccatgagacggctcttcgaatccatcaacaacctg
atgaaaagtcagtacaagaccaccatcctattgcaggtggcggctttgaaatacatccct
tcagtccttcacgatgtggaaacagtctttgatgccaagttgctcagccagctactgtat
gagttctacacctgcatccctcccgtgaagctgcagaagcagaaagttcagtccatgaat
gagatcgtgcagagcaacctcttcaaaaagcaagaatgccgggacattctgcttcctgtc
atcaccaaagagctgaaggagctgctggagcagagggacgatgggcagcaccaggctgag
aagaagcactgtgtggaacttctcaacagcatcttggaggtcctcagctgtcaggatgcg
gccttcacttatgaccacatccaagagatcatggtccagctgcttcgcacagtgaaccgg
acagtcatcacgatgggccgagatcacgctttgattagtcactttgtggcgtgtatgaca
gctatcttagaccagatgggcgaccaacactattcattttacattgagaccttccagacc
agctcagaccttgtggacttcttgatggagacattcatcatgttcaaggacctcattggg
aagaatgtgtatcctggggactggatggccatgagcatggtccagaaccgggtcttcctg
agagccatcaacaagtttgcagaaaccatgaaccagaagtttctggaacacacaagcttt
gagttccagctgtggaacaactattttcatctggcagttgcctttatcactcaggactct
ctgcagctggagcagttcacacacgctaagtacaacaaaatcctgaataagtacggggac
atgagacggctcataggattctccatccgtgatatgtggtacaagcttggccagaacaaa
atctgcttcatcccgggcatggtgggacctatattagagatgacacttatccctgaggct
gagctcaggaaagccaccatcccaatcttcttcgacatgatgctgtgtgaatatcaaagg
actggggctttcaaaaagtttgaaaatgaaatcatcctgaagctggaccatgaggtggaa
ggaggccggggggatgagcagtacatgcaactgctggagtccatcctgatggagtgcaca
gcggaacacccaaccattgccaagtcggtggagaactttgtgagcttggtcaaagggctg
ctggagaagttgctagattaccggggcgtgatgacagatgagagcaaagacaaccgtatg
agctgcacagtgaacttgctgaatttctacaaagataacaaccgggaagagatgtacata
agatacctgtataaactgcgtgaccttcacttggactgtgaaaactacacagaggctgcc
tacacactcctcctccacacctggcttctcaagtggtcagatgagcagtgtgcatcccag
gtcatgcagacaggccagcagcaccctcagacccaccggcagctgaaggagacactctat
gagaccattataggctactttgacaaaggaaagatgtgggaagaggccatcagcctgtgc
aaggaactggcggaacaatatgagatggagatctttgactacgagctactcagccagaac
ctgacccagcaggccaaattctatgaaaacatcatgaaaatcctcagaaccaaaccagac
tactttgctgttggatactatggccagggattcccctcctttctgcggaacaaagtgttc
atctaccgaggcaaggaatatgagcgaagagaagacttccagatgcagcttttgagccag
ttccccaacgcagaaaagatgaacacaacttctgccccaggagacgatgtgaggaatgcc
ccaggccagtacatccagtgtttcactgtgcagcctgttctggatgaacaccccaggttc
aagaacaaaccggtgcctgaccagatcataaacttttacaagtctaattatgtgcaaaag
ttccactactccaggcctgtgcgcaggggcaaggtagacccagagaacgagtttgcttcc
atgtggatcgagaggacttccttcctgacggcctacaagctgcctggcatcctgcgctgg
tttgaggtagttcacatgtctcagaccacaattagtcctctggagaatgccatcgagact
atgtccacagtcaacgagaagatcctgatgatgataaaccagtaccagagtgatgaaagc
ctccccatcaaccctctctccatgctcctcaatgggatcgtggaccctgctgtcatggga
ggcttcgccaagtatgagaaggccttcttcactgaagagtatagcagggagcacccggag
gaccaggacaagctgagccatctcaaggacctgattgcatggcagatccctttcctggga
gctgggattaagatccacgagaaaagggtgtcagacaacctgcgccccttccatgaccgg
atggaggagtgcttcaagaacctgaaaatgaaggtggaaaaggagtatggtgtccgagag
atgcctgacttcgaagacaggagagtgggccgccccaggtccatgctgcgttcctacagg
cagatgtccgtcatctctctggcctccatgcattctgactgcagcactcccagcaaagtc
cccgcagaaagttttgacctagagtcagccccacccaagactcccaaagtggaggaggag
cccatctccccagggagcactctgccagaggtcaagctgcggcggtccaagaaaaggacc
aagaggagcagcgtggtgtttgcagacgagaaggcagcaacggagtcagacctgaagcgg
ctttctagaaagcaagagttcatgagtgacaccaacctctcagagcatgcagccatccct
gccagggtgtctatcctctctcagatgagttttgccagccagtccatgcccaccatccca
gccctcacactctccgtggcaggcgtgcctgggttggatgaggccaacacatctccccgc
ctgagtcagaccttcttccaagtctcagatggtgacaagaagaccctgaaaaagaagaaa
gtcaatcaattcttcaagaccatgctggctagcaagtcgagtgaagaaagcaagcagatc
ccagacttcctgtccaccaacatgtga

DBGET integrated database retrieval system