KEGG   Mus musculus (mouse): 97895
Entry
97895             CDS       T01002                                 

Gene name
Nlrp4f, C330026N02Rik, C86045, Na, Nalp-kappa, Nalp4f
Definition
(RefSeq) NLR family, pyrin domain containing 4F
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    97895 (Nlrp4f)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    97895 (Nlrp4f)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    97895 (Nlrp4f)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   97895 (Nlrp4f)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 LRR_6 NOD2_WH LRR_4 AAA_16 NB-ARC AAA_30
Other DBs
NCBI-GeneID: 97895
NCBI-ProteinID: NP_780499
MGI: 2145528
Ensembl: ENSMUSG00000032999
UniProt: L7N1W9 Q3UX59 Q8BWZ1 Q4G0D0
LinkDB
Position
13; 13 B3
AA seq 937 aa
MASFISDFGLIWYLRELNKKEFMKFKDFLIQEILELKLKQVSSTKVKKASREDLANLLLK
CGENQAWDMTFRILQKINRKDLTERATGAIVGNPNLYRDHLKKKLTHDCPKKFNVRIQDF
IKETFIQNDYDAFENLLISKGTERKPHMVFLKGMAGVGKTLMLKNLMLAWSKGLVFQNKF
SYAFYFCCQDVKQLKTASLAELISREWPSPSAPIEEILSQPEKLLFIIDSLEGMEWDLTK
QESELCDDCMEKQPVSTLLSSLLRRKMLPESSLLLSTTPETFEKMEDRIQCTDVKTATAF
DERSMKIYFHRLFQDRKRAQEAFSLVRENKQLFTICQVPLLCWMVATCLKEEIEKGGDPV
SLCRRTTSLYTTHIFSLFIPQSAQYPSKKSQDQLQGLCSLAAEGMWTDTFVFGKEALRRN
GIFDSDIPTLLDIGMLGKIREFENSYIFLHPSVQEVCAAIFYMLKRHVEHPSQDVKNIET
VLFMFLKKVKTQWIFLGCFIFGLLQKSEQEKLGVFFGHRLSKNIHHKLYQCLETLSGNAE
LQEQIDGMRLFSCLFEMEDEAFLVKAMNCMQQINFVAKNYSDFIVAAYCLKHCSTLKKLS
FSTENVLNEGDQSYMEELLICWNNMCSVFVRSKDIQELRIKDTNFNEPAIRVLYESLKYP
SFTLNKLVANNVSFGDNHVLFELIQNSSLQYLDLSCSFLSHNEVKLLCDILNQAECNIEK
LMIAHCKLSPDDCKIFGSILMSSKSLKVLNLASNNLNQGISSLCKALCHPHCTLEYLVLS
NCSLSEQCWDYLSEVLRQNKTLSHLDISSNDLKDEGLKILCRSLILPYCVLESLCLSCCG
ITERGCQDLAEVLKNNQNLKYLHVSYNKLKDTGVMLLCDAIKHPNCHLKDLQLEACEITD
ASNEELCYAFMQCETLQTLNLMGNAFEVSRMVFFPRF
NT seq 2814 nt   +upstreamnt  +downstreamnt
atggcatctttcatttcagattttggccttatatggtatttgagagaactaaataagaag
gaattcatgaagtttaaggactttctcatacaggagattctggaattgaaactgaaacag
gtatcttcgaccaaagtgaagaaagcatctcgggaagatcttgccaacttacttctgaaa
tgtggggagaatcaagcctgggatatgaccttcagaatcctccagaagatcaataggaaa
gatctcactgagagggcaacaggagcgattgttggaaacccaaatttatatcgagatcat
ttgaagaaaaaactgacccatgattgtcccaaaaaatttaacgtccgtattcaagatttc
attaaagagactttcattcaaaatgactatgatgcttttgagaaccttctcatctcaaag
ggaactgaaaggaagccacacatggtgttcctgaaaggcatggctggagttggcaagaca
ctgatgttgaaaaatttaatgctggcctggtcaaaaggcctggtgtttcaaaacaaattc
tcttacgctttctacttctgctgtcaagatgtgaagcagttgaagacagccagccttgct
gaacttatctccagagagtggcccagcccctcggctcctatagaggagatcctatcccaa
cccgagaaactcttatttatcattgacagcttggaagggatggaatgggatttaaccaaa
caggaatcagagctgtgtgatgactgcatggagaagcagccagtgagtacactgctgagc
agtttgctcaggaggaagatgctccctgaatcctctctcctcctctccactaccccagag
acttttgagaaaatggaggacaggattcagtgcacagatgtgaagacagcaactgcattt
gatgagaggagtatgaagatatatttccacagattgttccaagataggaagagagcccag
gaggccttcagtttggtgagagaaaacaagcagctgttcactatatgtcaggtccctctg
ctctgctggatggtggctacttgtctaaaagaggagatagagaagggaggagacccagtc
tccctctgccgacgtaccacctccctatataccactcacatcttcagtttgttcattccc
caaagtgcccagtatccaagtaagaaaagccaagaccagctgcagggcttatgttctcta
gctgctgagggcatgtggactgacacatttgtgtttggcaaggaggctctcaggagaaat
gggatctttgactctgacatccccacacttttggacattggaatgcttggaaagatcaga
gaatttgagaattcttacatattcctccacccatctgttcaggaggtctgtgctgccatc
ttttatatgctaaagaggcatgtggaacaccctagccaggatgttaaaaatatagagaca
gtcttgtttatgtttttaaagaaagtaaaaacacagtggatttttttgggctgtttcatc
tttggtcttttacagaaatcagaacaagaaaagctaggggtattttttggccaccggttg
tccaagaacatacaccataagttatatcagtgcctggaaaccttaagtggcaatgcagag
cttcaagaacaaatagacggcatgagattgttttcctgtctgtttgagatggaagatgaa
gccttcctagtaaaagcaatgaattgtatgcaacagattaactttgtggctaagaattat
tctgattttattgttgctgcttattgcttgaaacactgttctacactgaagaaactatcc
ttttcaactgaaaatgtcctgaatgaaggagaccagagttatatggaagagctacttatc
tgttggaataatatgtgctctgtgtttgtaaggagtaaagacattcaggaactccgaata
aaagacactaatttcaatgagccagccattcgagttttatatgaatctctgaagtacccc
agcttcacccttaacaaacttgtggcaaataatgtgtcctttggtgataaccacgtgctc
tttgagttgattcagaattccagtttgcaatacttggacctcagctgctcatttctgtcc
cacaatgaggtgaaactgttgtgtgatatcttgaaccaggcagagtgcaacatagaaaaa
cttatgatagcacactgtaaactttcacctgatgactgcaagatctttggctccatcctg
atgagcagcaagtcgttgaaggttcttaatttggcatccaacaatttgaatcaaggaata
tcctcactgtgcaaggctttgtgccacccacactgtactctggagtacttagtgctgtcc
aactgttccctcagtgagcaatgttgggactacctttctgaagttcttaggcagaacaaa
actctgagccatctagacatcagctccaatgacctgaaggatgaaggactgaagattctc
tgtaggtctctgattctcccatactgtgtcctggagtcactatgtttgagctgttgtgga
atcaccgaaaggggctgccaggatctggctgaagtcctgaagaacaaccagaacctgaag
tacctacatgtttcatacaataagctaaaagacactggtgtgatgctgctgtgtgatgct
ataaaacatcctaactgccacttaaaggatctacagttggaagcctgtgaaataactgat
gccagtaatgaggagctttgttatgcttttatgcagtgtgagaccctgcagacgctcaac
ctcatggggaatgccttcgaagtcagtagaatggttttctttcccaggttctga

DBGET integrated database retrieval system