KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_0021Help
Entry
MYCMA_0021        CDS       T02177                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Brite
KEGG Orthology (KO) [BR:mmv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmv01001]
    MYCMA_0021
Enzymes [BR:mmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MYCMA_0021
Protein kinases [BR:mmv01001]
 Serine/threonine kinases: Other
  Bacterial family
   MYCMA_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 RuvA_C WaaY MAP17
Motif
Other DBs
NCBI-ProteinID: AFN62203
LinkDB All DBs
Position
4656013..4657899
Genome map
AA seq 628 aa AA seqDB search
MTTPQHLSDRYELGEILGYGGMSEVHLARDLRLNRDVAIKVLRADLARDPSFYLRFRREA
QNAAALNHPAIVAVYDTGEAETETGPLPYIVMEYVDGITLRDIVKDDGPMPIRRAIEVIA
DSCQALNFSHQHGIIHRDVKPANIMISKTGAVKVMDFGIARAVSDAGNSVTQTAAVIGTA
QYLSPEQARGETVDARSDVYSLGCVLYELLTGEPPFVGDSPVAVAYQHVREDPVAPSKHN
PEIPPGLDSVVLKALSKNPDNRYQNAAEMRADLMRVYQGEQPEAPKVLTDAERSTMLSTP
ANTRAFPASGPQTSPLPSQYEEPRRNPLSRWLVGLAALVVLTIIVTFAIILGNGPSRDVQ
VPDVTGKSQSDAVAALQNLGFKTKVQKNTSSKVAPEKVIDTDPAKGSTVSAGAEVTVNVS
IGPENQQVPDCHGLSFGDAVKKLQAAGFKGTFTQSETKSLPEDKGRVMATNPPAGQYSAV
TNNITIVVGKGPGEKPVPDLGGQNIDVAIKNLPTYGFTAPPTVIPVPSPESKGQILSTNP
PANTMFPEDGVIEIRVSNGGQFRMPNIMGKFWTDAEPMLYQAGWQGGGLSTEDVPSDGNN
RARVVFQDPPAGAGVGYNGPIKLRFGAG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaccactccgcagcacctctcggaccgctatgagctgggggagatcctcggctatggc
ggcatgtccgaggtccacctggcacgcgacctgcggttgaaccgcgacgtcgcgatcaag
gtgctgcgcgccgacctggcccgggaccccagcttctatctccgtttccgtagggaggcc
cagaacgccgccgccctgaatcaccccgcgatcgtcgccgtctacgacaccggcgaggcc
gagaccgagaccgggccgctgccctacatcgtgatggagtacgtcgacggcatcaccctg
cgtgacatcgtcaaggacgacggccccatgccgatccgccgggccatcgaagtcatcgcg
gactcgtgccaggcactcaatttcagccaccagcacggcatcatccatcgcgacgtcaag
cccgccaacatcatgatcagcaagaccggcgcggtgaaggtgatggacttcggcatcgcg
cgcgcggtctccgatgccgggaacagcgtcacgcagaccgcagcggtaatcggtaccgca
cagtacctttcgccggaacaggcgcgcggcgagacagtcgacgcccgctccgatgtctac
tcgctgggctgcgtcctttacgaattgctcaccggcgagcctcctttcgtgggcgactca
cccgtcgcggtggcctaccagcatgtgcgggaagatcccgtagccccgtccaagcacaac
cccgaaattccgcctggcctggattccgttgtgctcaaagcgctttccaagaatcccgac
aaccgctaccagaacgccgccgagatgcgcgcagacctgatgcgggtgtaccagggcgag
cagccggaagcgcccaaggtgctgaccgacgccgaacgcagcacgatgctcagcacacct
gcgaacacgcgggcctttcccgcctcgggaccacagaccagcccgctgccaagccagtac
gaggagccgcgccgcaatccgctgagccgctggctggtcggcctggcggcgctggtggta
ctcaccatcatcgtcaccttcgccatcatcttgggcaacggaccatcacgggatgtccag
gttcccgacgtcaccggcaagtcgcagtccgatgccgtcgccgcgctacaaaacctggga
ttcaagaccaaggtccaaaagaacaccagctcgaaggtggcgcccgagaaggtcatcgac
accgacccggccaagggctcgacagtgtccgccggggccgaggtgacggtgaatgtgtcc
atcggaccggagaatcagcaggtgcccgattgccacggcctgagcttcggcgacgccgtg
aagaaactgcaagccgctggtttcaagggcaccttcacccagagcgaaaccaagtccctg
cctgaggacaagggccgcgtcatggcgaccaatccgccggccggtcaatactcggccgtc
accaacaacatcaccatcgtggtgggtaagggcccgggggagaagcccgtgcctgatctc
ggcggccagaacatcgacgtcgccatcaagaacctgccgacctacgggtttaccgcaccc
cccacggtgatcccggtgcccagccccgaatcgaaggggcaaatcctgagcacgaatccg
cccgcgaacaccatgttcccggaagacggggtcatcgagatccgggtgtccaatggcggg
cagttccgcatgccgaacatcatgggcaagttctggaccgatgccgagcccatgctgtac
caggccgggtggcagggcggcggcttgagcaccgaggatgtgccgtccgacggcaacaat
cgggcccgcgtggtgttccaggatccgcccgccggcgccggggtcgggtacaacggcccg
atcaagctgcgcttcggcgcaggctag

DBGET integrated database retrieval system