KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_0070Help
Entry
MYCMA_0070        CDS       T02177                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Brite
Enzymes [BR:mmv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MYCMA_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFN62251
LinkDB All DBs
Position
4564272..4564895
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGVNDAVAKLEEAREKGDHAAIF
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGDLAAAIDDQFGSFDKFQAQFTAAANGL
QGSGWAVLGYDSLGQKLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQDRYTAATTKTSGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagtacacactgcccgatttggactatgactacggagcgctggagccccacatc
tcgggacagatcaacgagctgcaccacagtaagcaccacgcgacctacgtcaagggtgtt
aacgacgctgttgccaagttggaggaggcccgcgaaaagggcgaccacgccgcgatcttc
ctcaacgagaagaacctggcgttccacctcggcggccacgtgaaccactcgatctggtgg
aagaacctgtcccccaacggcggtgacaagccgaccggcgatctggccgctgccatcgac
gatcagttcggttcgttcgacaagttccaggcacagttcaccgccgcggccaacggtctg
cagggctcgggctgggcggtgctcggttacgacagcctcggacagaagctgctgaccttc
cagctgtacgaccagcaggccaatgtccctctgggcatcatcccgctgctccaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtgaaggca
ttctggaacgtggtcaactgggccgacgtgcaggaccgctacaccgcggccaccaccaag
acgtcgggtctgatcttcggctga

DBGET integrated database retrieval system