KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_03370Help
Entry
MYCMA_03370       CDS       T02177                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AIC71077
LinkDB All DBs
Position
240939..242612
Genome map
AA seq 557 aa AA seqDB search
MSDTGIRQHVEINAPAMKSGAIDYLGLLRAGLEELDFYDSRRHLYTRAGADLVVDIRIRA
AALRERGLRRGDRVAMTATSDEEYLATLLAVLLLGAVPCAIAPPPTPSRPDSAGVAHLRA
ALEVLSPAMVIAQPRVMVAVVHPNVLSYDQLADANPIDWELLSTAHPADVHHIQLTSGST
SAPKAVVLTHGNVVHNASAIAYGTRASRGRDRVFSWLPFYHDMGFIQVLAALLYGLRVGV
MTPMGFLRDPISWLRHMSHHGSTHTAGPPFAYRAISDAIGRGGPLVDVDLSSLRHAYVGA
EPIPYPVVCDVTARLRLLGMRNDVLVPCYGMAETVLATSIALQPYPPGETAFGRVYGRRS
PENGQLVVSCGRPVDGLRVRVLSSDGEVLADGAVGDIQVSGPSVMRGYLRPDGGVVAPEG
GWHSTGDRGYLDGGELFVVGRRKEMLIVRGRNFPPYDVERQIDQLSGAGGVSVVFTVQDE
QRVRESVVAVVGTRAALCEYEGLRSRVAGGVRAAFGFSLDDVVVVPARVIPRTTSGKRQR
LKVREAYLSGLLSPAGG
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatactgggattcgtcagcacgtggagatcaatgcgccggctatgaagtccggc
gcgattgattatctcgggctgcttcgtgcgggactggaagagctcgatttctacgattcg
cgacgccatctgtacacacgtgcgggtgcagatctggttgttgacatccggatccgtgct
gcggcgctacgcgagcgtggactgaggcgcggtgatcgagtcgccatgaccgccaccagc
gacgaagaatacctggcgacactgttggccgtgctgttgttgggtgcggtgccctgcgcg
atcgcgccgccgcccactccctcgaggccggactccgcgggagtagcgcatcttcgcgcc
gcgcttgaggtgttgagccccgctatggtcattgcccagccacgtgtcatggtggcggtc
gtgcatccaaacgtgttgtcgtacgatcagcttgcggatgccaatcccattgactgggag
ctactttcgactgcacacccagcagacgtgcaccacatacagcttacctcgggctcgacc
tccgcgccgaaggcagtagtgctgacccatggcaatgtcgtgcataacgccagtgcaatc
gcctacggcacaagggcatcgcggggccgcgatcgggtgttcagctggctgcccttctat
cacgatatgggctttatccaggtgttggccgcactgctctacggtctccgagtgggggtg
atgaccccgatgggatttctgcgcgatccgatctcctggctacgacacatgtctcatcac
gggtcgactcacaccgcgggtccaccgttcgcgtatcgggcgatatcggacgcgatcggt
cgcggcggcccgcttgtagatgtggatctgtcctccctgcgtcatgcctacgtgggtgcc
gagcccatcccttacccggtggtgtgtgacgtcaccgcgcggcttcgtttgttgggtatg
cgtaacgacgtgttggtgccgtgctacggcatggcggaaacagtgctcgcgacaagcatt
gcgctgcaaccatatccaccgggagaaacagcattcggccgggtttacggccggcgtagt
ccggagaacggtcaattggttgtgtcgtgtggtcggccggtcgacggcttgcgggtgcgc
gtcctttcgtccgatggtgaagtacttgctgatggagctgtcggcgatattcaggtgagt
gggccgtcggtaatgcggggctacttgcgtcccgacggcggggtagtcgcgcccgagggc
ggatggcacagcactggtgaccgcggctatctcgacggcggtgaactctttgtggtgggg
cgtcgcaaggagatgctcatcgtgcgggggcgcaacttcccgccctacgacgtcgaacgg
caaatcgaccagctctctggtgccggtggagtttccgttgtgttcacggtgcaggatgaa
cagcgcgttcgcgagtcggttgtggccgtggtaggaacgcgggcggccttatgcgagtac
gagggactgcgtagccgtgtggccggtggtgtgcgcgcggcgttcgggttttcactggat
gacgtcgtcgtggtgccggcacgtgtgattccccggaccaccagcggaaaacgtcagcga
ctgaaggtgcgtgaggcgtatctgtccgggctgttgtcaccggccggaggctga

DBGET integrated database retrieval system