KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_1367Help
Entry
MYCMA_1367        CDS       T02177                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase II
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00380  Tryptophan metabolism
mmv00630  Glyoxylate and dicarboxylate metabolism
mmv01110  Biosynthesis of secondary metabolites
mmv01130  Biosynthesis of antibiotics
mmv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MYCMA_1367 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MYCMA_1367 (katE)
Enzymes [BR:mmv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MYCMA_1367 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AFN63509
LinkDB All DBs
Position
2388140..2390248
Genome map
AA seq 702 aa AA seqDB search
MDHTSNPKQEQLDTSRVDRASGYLTTQQGVRVDHTDDALTAGVRGPTLLEDFHAREKVTH
FDHERIPERVVHARGAGAYGYFEPYDAWLSDFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTQQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAASA
HDTLWDFVAEQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNDAGEGVFVKFHWKP
LLGVHSLLWDECQQIAGKDPDFNRRDLWDAIESGQFPEWELGVQLVPESDEFKFPFDLLD
ATKIIPEEQVPVQPVGRMVLDRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPIAEVHNNQQDGFAQHDIPQGKSSYFKNTLGGGCPALAHE
DVFRHYTQRVDGHKIRQRAESFKDFYSQARMFWKSMSAIEAQHIVSAFSFELGKVSAESG
IRERVVVQLNLVEHDLASQVALQLGLPAPAPQSADEALPPSPALSQLSSTRDSVATRRIA
VLAADGVDIHGVDLLRTALEESDAIVEILAPTGGGTLTGESGGELRVDRAMTTMASVLYD
AVVVPSGAESAWRLARNGFAVHFVSEAYKHLKPVAAYGAGLDLLRAASVVETLATTAEIV
VDDGVVTTTAEASALPAEFVAAFVTAISRHRAWERETEMVPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacacgtcgaatcccaaacaagagcaactcgacacgtctcgggtggaccgcgcc
tctggttatctcactacccagcaaggcgttcgcgtcgaccacaccgatgacgcgctcacc
gccggcgtcaggggccccacgttgctggaggatttccacgcgcgcgagaaagtcacgcat
tttgaccacgaacgaattccagagcgtgtggttcatgcgcgcggcgcgggcgcatacggc
tatttcgagccgtacgacgcgtggctatcggacttcacagccgcgaaatttctcaccaca
cccggcctgcgcacaccggtgttcgttcgtttctctaccgttgcgggctcccgcggctcg
gcagacaccgtgcgcgacgtacgtggatttgccacgaaattctatacacagcaaggaaat
tacgatctggtcggtaacaatttcccggtattcttcatccaggacggcatcaaattcccg
gacttcgtgcacgcggtgaagcctgagcccgacaacgagatcccgcaggccgcctcggcg
catgacaccttgtgggacttcgtggccgagcagcccgagacgctacacgcgatcatgtgg
ctcatgtccgatagggctctgccccgcagctaccgcatgatgcaagggttcggcgtacac
accttccgattggtcaacgacgccggcgagggcgtttttgtgaagttccactggaagccg
ctgctaggcgttcactcactgctgtgggacgaatgtcagcagatcgccggcaaggacccc
gatttcaaccggcgcgatctctgggacgcgatcgagtccggccagtttccggaatgggag
ctcggagtgcaactggtaccggaatccgacgagttcaaattccccttcgaccttcttgac
gcaacgaaaatcattccggaagaacaggttccggtgcagcctgtcggacgcatggtgctg
gatcgcaaccccgacaacttctttgccgagacagaacaggtcgcattccacacggccaat
gtggtgccgggaatcgacttcaccaacgacccgctgcttcagtttcgtaacttctcctac
ctggatacacaactgatccgcctaggcggcccgaacttcgcacaactgcccatcaacaga
ccgatcgccgaggtgcacaacaaccagcaagacggcttcgcgcagcatgacatcccacaa
ggcaagtcaagctatttcaagaacaccctcggcggcggctgcccggccctggcgcatgaa
gatgtcttccgccactacacccaacgagtggacgggcacaagatccgccagcgcgccgag
agcttcaaggatttctacagccaggcgcggatgttctggaagagtatgtccgccatcgag
gcgcagcacatcgtttcggcgttctcgttcgaactgggcaaggtgagtgccgagtccggg
attcgcgaacgtgtggtcgttcaactcaacctggtggaacacgatcttgcttcccaagtc
gccttgcagctgggcttacctgccccggcgccgcaatcggccgacgaggctcttccgccg
tccccggcgctgtcccagctctccagcacccgagacagcgtcgccacccgacggatcgcg
gtgctcgcagccgacggtgtcgacatccatggcgtggatctccttcgtacggcgctggaa
gagagcgacgcgattgtcgagatactcgcaccgactggcggcggaacgctcaccggcgaa
tccggcggcgaactccgcgtcgaccgcgcgatgaccaccatggcctcggtgttatacgac
gccgtggtcgtaccgtccggagccgaatccgcctggcggctggcgcgcaacggattcgcc
gtgcatttcgtttccgaggcctacaaacatctcaagcccgtcgcggcctacggtgccggg
ctcgatctgctccgggcagcctctgtggtggaaacactcgccaccaccgcagagattgtg
gttgacgacggcgtggtgacgaccaccgcggaagccagtgcattgccggccgaattcgtg
gccgcgtttgtcacggcgatcagccggcatcgcgcctgggaacgcgagaccgagatggtg
cccgcatag

DBGET integrated database retrieval system