KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_2054Help
Entry
MYCMA_2054        CDS       T02177                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00473  D-Alanine metabolism
mmv01100  Metabolic pathways
mmv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MYCMA_2054
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MYCMA_2054
Enzymes [BR:mmv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MYCMA_2054
Peptidoglycan biosynthesis and degradation proteins [BR:mmv01011]
 Precursor biosynthesis
  Racemase
   MYCMA_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFN64186
LinkDB All DBs
Position
1154240..1155457
Genome map
AA seq 405 aa AA seqDB search
MGPVSTTSTTTDGLPPSTGATAAQAVIDLGAIAHNVKLLREHAGTARLMAVVKADGYGHG
AVRVARAALAAGADELGVTSITEALQIRAAGLDAPLLAWLHAPGADYAAALHADVEVAVS
SLGQLGELLAAARSTGRQAITSIKVDTGLNRNGVPAGYTRDLFEALAKAQAEESIRLRGI
MSHFAYADQPGHPTIDMQIGRFNEALELARGFGLRYELAHLSNSAATLTRPDARYDMVRP
GIAVYGINPLGAAESATSNRGRTSFDLIPAMSLTCAVSSVKPVSAGEGVSYGHVWTAPRD
TNAALIGIGYADGVVRGLGNRFEVAIGGRRYPNIGRVCMDQFVVDLGDNDAGVQAGDVAT
LFGPGTAGEPTAQDWAELLDTIAYEVVTGPRGRVVRTYRDSRAVE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggggccggtgagcacgacttcgacgacaaccgacggccttccgccgagcaccggtgcg
acggccgcgcaagcggtcatcgacctcggcgccatcgcgcataacgtcaagttgctgcgt
gagcacgccggtacggcccgtctcatggctgtggtcaaggccgacggctacgggcacggc
gcggttcgggtggcacgagccgcgctcgctgccggtgccgacgagcttggcgtcacctcc
atcaccgaggcgctgcagattcgcgcggccggtctcgacgcaccgctgctcgcctggcta
cacgcgccgggagccgactatgcggccgcgctgcatgccgatgtcgaggtcgccgtgtcc
tcgctcgggcagctcggtgagttgcttgcggcggcgcgatccaccgggcgccaggcgatc
acgtccatcaaggtggataccggactgaatcgcaacggagtgcccgccgggtacacccgt
gatctcttcgaagcgttggccaaggcgcaggccgaggagtcgattcgtctgcgcggcatc
atgtcccacttcgcgtatgccgaccagccgggccatcccaccatcgacatgcagatcggg
cggttcaacgaggcccttgagctggcacgcggcttcggattgcgttatgagctggcgcac
ctatcgaattcggcggccactctcacccgtcccgatgcgcggtacgacatggtgcgcccc
ggtatcgcggtgtacggcatcaacccgcttggagccgcggagtcggcgacatccaaccgc
ggccggacttcctttgatctgattccggcgatgtcgctgacgtgcgcggtgtcctcggtc
aagccggtgtcggccggagagggtgtgtcctacgggcacgtgtggaccgccccacgcgat
accaacgcggcactcatcgggatcggctacgccgacggcgtggtgcgcggactgggcaat
cgattcgaggtggccatcggcggacgccgctatcccaatatcggccgggtttgcatggac
cagttcgtggtcgatctgggtgacaacgatgccggagtgcaagccggtgatgtggcaacg
cttttcgggccgggaacagccggcgagccgactgcgcaggactgggcggagctgctcgac
accatcgcctacgaagtggtcaccggcccgcggggcagggtggtgcggacgtaccgggat
tccagggccgttgagtaa

DBGET integrated database retrieval system