KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_2055Help
Entry
MYCMA_2055        CDS       T02177                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00250  Alanine, aspartate and glutamate metabolism
mmv00410  beta-Alanine metabolism
mmv00430  Taurine and hypotaurine metabolism
mmv00650  Butanoate metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01120  Microbial metabolism in diverse environments
mmv02024  Quorum sensing
Module
mmv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYCMA_2055
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCMA_2055
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCMA_2055
   00430 Taurine and hypotaurine metabolism
    MYCMA_2055
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MYCMA_2055
Enzymes [BR:mmv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MYCMA_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AFN64187
LinkDB All DBs
Position
1152794..1154224
Genome map
AA seq 476 aa AA seqDB search
MSKSPDQFRLSAHAGKINASAFSPAYTGRLSTAPVPALRLPDEPMDPQAAYRFIHDELML
DGSSRLNLATFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIESRCVAMVADLFHADN
LSTEDPSSAVGVSTIGSSEAVMLAGLALKWRWRAKIGGTDGTAWKGRTPNLVMGSNVQVV
WEKFCRYFDVEPRYLPMAKGRYVITPEQVLEAVDEDTIGVVGILGTTFTGELEPIAAICA
ALDKLAATPGKPDVPVHVDAASGGFVVPFLHPELHWDFRLPRVVSINVSGHKYGLTYPGI
GFVVWRSKEHLPEDLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYAQVMR
CLSETARWFGDELGKSEHFEVITDGSAIPVVSFRLKGKRPYTEFDISHSLRAFGWQVPAY
TMPEDVTDIAVLRVVVREGFSGDLARALRDDLNTVLKGLDELKPNGHFDEVQPFAH
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaatcccctgatcagttccgtctctcggcgcatgccggaaagatcaatgcctcc
gcgttcagccccgcgtataccggcaggctgtccacggcacccgtcccggcgctgcggctg
cccgacgagccgatggatccgcaggccgcctatcggttcatccacgacgagctgatgctc
gacggcagctcgcggctgaacttggcgaccttcgtcacgacgtggatggatcccgaggcc
gaaaagctgatggccgagacattcgacaagaacatgatcgacaaggacgagtatccggcg
acggccgcgatcgagtcgcgatgcgtggccatggtggccgacctgttccatgccgacaac
ttgtccacagaggatccgtcctcggcggtgggcgtgtcgaccatcggatcgagtgaggcg
gtcatgctggccgggctggccctcaagtggcgttggcgcgcgaaaatcggcggtaccgac
ggcaccgcctggaagggacgcacacccaacctggtgatgggttccaacgtgcaggtggtc
tgggaaaaattctgccggtacttcgacgtcgaaccgagatacctgccgatggccaagggc
cggtatgtgatcactcccgagcaggtgcttgaggcggtcgacgaggacaccatcggcgtt
gtcgggatcctgggcaccacgttcaccggagagctggagccgatcgccgcgatctgcgcg
gcgctggacaagctcgctgctacacccggcaagcccgatgtgcccgtgcacgtcgatgcc
gccagcggtggtttcgtggtgcctttcctacatcccgaactgcactgggacttccggctg
ccgcgggtggtgtcgatcaatgtcagcggacacaagtacgggctgacctatcccgggatc
ggctttgtggtgtggcgcagcaaggagcatctgcccgaagacctggtgttccgggtcaac
tacctgggtggcgacatgccgaccttcaccctgaacttttcccgcccgggcaaccaggtg
gtggggcagtactacaacttcctgcgactgggccgggccggatatgcacaggtgatgcgc
tgtctgtcggagacggcacgctggttcggtgacgaactcggcaagagtgaacatttcgag
gtgatcaccgacgggtcggcgatcccggtggtgtcattccggctcaaaggcaagcggccg
tacaccgagttcgacatctcgcattcgttgcgggcatttggctggcaggtgcctgcgtac
accatgcccgaagacgtcaccgatatcgccgtgctgcgagtggttgtgcgcgagggcttc
tcgggagatctggccagagcgctgcgcgatgatctcaacaccgtgctcaagggactcgac
gagctgaaaccgaacggacacttcgacgaggtgcagccgttcgcccattag

DBGET integrated database retrieval system