KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_2385Help
Entry
MYCMA_2385        CDS       T02177                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00220  Arginine biosynthesis
mmv00250  Alanine, aspartate and glutamate metabolism
mmv00290  Valine, leucine and isoleucine biosynthesis
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01130  Biosynthesis of antibiotics
mmv01210  2-Oxocarboxylic acid metabolism
mmv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCMA_2385
   00290 Valine, leucine and isoleucine biosynthesis
    MYCMA_2385
   00220 Arginine biosynthesis
    MYCMA_2385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmv01007]
    MYCMA_2385
Enzymes [BR:mmv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MYCMA_2385
    2.6.1.66  valine---pyruvate transaminase
     MYCMA_2385
Amino acid related enzymes [BR:mmv01007]
 Aminotransferase (transaminase)
  Class I
   MYCMA_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFN64513
LinkDB All DBs
Position
complement(568570..569880)
Genome map
AA seq 436 aa AA seqDB search
MDSNATIETVSTDNLPIDVPPRVPGLSPRQHQRVFAQSTKLQDVLYEIRGPVHAHAARLE
AEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGILPARRAVVTRYELVD
GFPYLDVDDVFLGNGVSELITMTTQALLDNGDQVLIPAPDYPLWTAATSLAGGTAVHYLC
DETNGWMPDIEDLESKITERTKALVIINPNNPTGAVYSREILTKMVELARKHQLLLLADE
IYDKILYDDAEHISVASLAPDLLCFTFNGLSKAYRVAGYRSAWLAITGPKDHAASLLEGV
NLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKP
QGALYAFPRLDPEVHHIHDDDQLVLDLLLNEKILLTQGTGFNWPEPDHLRIVTLPWARDL
AVAIERLGNFLASYRQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ctggacagcaatgccaccattgagaccgtgagtaccgataacttgccgattgacgtgccc
ccgcgcgtgcccggcctttcgccgcggcagcatcagcgggtcttcgcgcagtccaccaag
ctacaagacgtcctgtacgaaatcaggggtccggtacacgcacacgccgcccggctcgag
gctgagggtcatcgcatcctcaagctcaacatcggcaaccctgcgccgttcggattcgag
gcgcccgatgtcatcatgcgcgacatcatccaggcgctcccctacgcacagggctactcc
gactccaagggcatcctgcccgcccggcgcgcggtggtcacccgctacgaactggtcgac
gggttcccgtacctggatgtggacgacgtcttcctgggcaatggggtatccgagctgatc
accatgaccacccaggcgctgctcgacaacggcgaccaggtgctcatcccggcgcccgac
tatccgctgtggaccgccgcgacctcacttgccggcggcaccgcggtgcattacctgtgc
gacgagaccaacggctggatgcccgatatcgaggatctggaatccaagatcaccgagcgc
accaaggccctcgtcatcatcaacccgaacaacccgaccggcgcggtatacagccgcgag
atcctcacgaagatggtcgaactggcccgcaagcatcagttactgctgctggccgacgag
atctacgacaagatcctgtacgacgacgccgagcacatcagcgtcgcgtcacttgccccg
gatctgttgtgtttcaccttcaatggcctgtccaaggcatatcgagtggctggctaccgg
tcagcatggcttgccatcaccgggcccaaggaccacgccgccagcctgctggaaggcgtg
aacctgctggccaatatgcgactgtgcccgaatgttcctgcccagcatgcgattcaggtg
gccctcggtggacaccagagcatcgaggatctggtgttaccgggtggtcgcctgctggag
cagcgcgatgtcgcctggacaaagctcaacgagatccccggtgtctcctgcgtcaagccg
cagggtgcgctctacgcgttcccgcgcctggaccccgaggtgcaccatatccacgacgac
gaccagctcgtcctggatctgctgctcaacgagaagatcctgctgacgcagggcaccggc
ttcaattggcctgagcccgaccatcttcggatcgtcacgttgccatgggcccgcgacctt
gccgtcgccatcgagcgcctgggcaacttcctggcgagctaccgccagtag

DBGET integrated database retrieval system