KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_2454Help
Entry
MYCMA_2454        CDS       T02177                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00250  Alanine, aspartate and glutamate metabolism
mmv00410  beta-Alanine metabolism
mmv00640  Propanoate metabolism
mmv00650  Butanoate metabolism
mmv01100  Metabolic pathways
mmv01120  Microbial metabolism in diverse environments
Module
mmv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCMA_2454
   00650 Butanoate metabolism
    MYCMA_2454
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCMA_2454
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCMA_2454
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmv01007]
    MYCMA_2454
Enzymes [BR:mmv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MYCMA_2454
Amino acid related enzymes [BR:mmv01007]
 Aminotransferase (transaminase)
  Class III
   MYCMA_2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF982
Motif
Other DBs
NCBI-ProteinID: AFN64581
LinkDB All DBs
Position
490406..491683
Genome map
AA seq 425 aa AA seqDB search
MPVGLRASGSSATALSPVLKQATPVVAARGQGCYLYDETDREYLDFTAGIGVVSTGHCHP
RVVEAAQRQVATLIHGQYTTVMHRPLQNLVRRLGEVLPPSLNSLFFANSGSEAIEAAVRL
ARQATGRPNIVVFQGGFHGRTLAAATMTTSGPRFSSGIGPLMAGVYSAPFPTAYRYGWSE
AEATRFALQELDYLFATATAPGQVAAMVIEPVLGEGGYIPANTEFLTGIAERAREHGILL
VLDEVQTGFGRTGQYFGHQHFGVTPDVLVMAKGIASGFPISGIAASAELMGRAWPGSQGG
TYGANAVACAAALATLDVIDEEGLVDNARARGQELLDGARKIAADRGIDGDVRGLGLMVG
VEFSQDGRPAPQRAARAQAAAAENGLLLLMCGPHMNVVRMIPPLVVTADQISDALGIWSS
VVAGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcggtcttcgcgcaagcggctcatccgcaaccgcgctatcacccgttctcaag
caggccaccccagtggtggcggcgcgaggccagggttgctatctgtacgacgaaacagac
cgcgaatacctggatttcaccgcgggaatcggtgtggtgagcaccggccattgccatccg
cgcgtggtcgaggccgcgcagcggcaggtagccaccctcatccacgggcagtacacgacg
gtgatgcaccgcccgctgcagaatttggtgcggcgcctcggcgaggtactcccgcctagc
ctgaattcactgtttttcgccaactctggcagtgaagccatcgaggctgccgtgcggctg
gcgcgtcaggccaccggacgtcccaatatcgttgtgttccagggcggatttcatggccgc
acactggccgccgccacgatgaccacctccggaccgcgattctcctcgggaatcggtcca
ctgatggcgggtgtatacagcgctcccttccccacggcgtaccggtacggctggagcgag
gccgaggccacacggttcgcgctgcaagagctcgactacctgttcgcgacggccaccgcc
ccgggccaggtcgcggcgatggtcatcgagccggtactcggcgagggcggctacatccct
gccaataccgaattcctcaccggaattgccgagcgcgcgcgcgagcatggcatcctcttg
gtcctcgacgaggtgcagaccggattcgggcgcaccgggcaatacttcgggcaccagcat
ttcggcgtcacaccggatgttctggtgatggccaagggaatcgcgagcggattccccatc
tcgggcatcgctgcctccgccgagttgatggggcgtgcctggccgggttcgcagggcggt
acctacggggccaacgccgtcgcatgtgccgctgcgctggccactctcgacgtgatcgac
gaggagggcctcgtcgacaatgcgcgtgcgcggggccaggaacttctcgatggggctcga
aagatcgccgctgacagaggaatagacggagacgtacgcggcctcggactgatggtcggc
gtggagttcagccaggatggccgaccggcaccgcaacgtgcggcgcgggcacaagcagca
gccgccgagaacggtctattgctactcatgtgcggcccgcacatgaacgtggtgcgcatg
attccgccgctggtggtgacggccgatcagatatccgatgctctcggtatctggagcagt
gtggtggcggggctgtga

DBGET integrated database retrieval system