KEGG   Marinomonas sp. MWYL1: Mmwyl1_0354Help
Entry
Mmwyl1_0354       CDS       T00567                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mmwyl1_0354
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mmwyl1_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Thioredoxin_3 Pyr_redox GIDA FAD_binding_2 FAD_oxidored HI0933_like DAO NAD_binding_8 Glutaredoxin FAD_binding_3 Thi4 AlaDh_PNT_C K_oxygenase Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ABR69292
UniProt: A6VS63
LinkDB All DBs
Position
complement(409624..411171)
Genome map
AA seq 515 aa AA seqDB search
MLEANLKQQLGTYLQNIVNPIEITVSTNSSAKSNELLELAREITELKSDKITLTVNENST
GRAPLMAIAPKGETPRVSFAGIPMGHEFTSLVLALLQAGGHPSKAAQETLEQIKSLDTKL
NFEVYISLSCHNCPDVVQAVNLMAVLNPNITATMIDGSMFQDEVNERNIMAVPSVYLNGE
LFGQGRMTLAEIVNKVDTGAADKQAAALAEKAPYDMLVVGGGPAGAAAAIYAARKGIRTG
VVAERFGGQVSDTMAIENFISVKATDGPKLVAGLEQHVLDYDVDLMKLQKAVRLEKKEFI
EVELENGAILQSKSVVLATGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTAVIGG
GNSGIEAAIDLAGITEHVTVLEFSDTLRADDVLVKKAQSLPNVTIIKNAMTTEVMGDGQR
VIGLKYTDRLTDESHLVDVAGIFVQIGLVPNSEFLKETLELSNRGEIIVNAHGETSIPGV
FAAGDVTTAPYKQIVISMGSGATAALGAFDYLIRN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagcaaacttaaaacagcagttgggcacatacctgcaaaatatcgttaatccg
attgaaattactgtgtccacaaacagttctgcaaaatcaaacgaattacttgaattggct
cgcgagatcaccgagctaaaaagcgacaaaattacattaacagtcaatgaaaactcgact
ggtcgtgcacctttgatggctattgcgccaaagggagaaacaccacgagtgagctttgct
ggcattccaatgggtcacgaatttacttcgcttgtgctagcactattacaagcaggcggc
cacccatcaaaagccgcgcaagaaaccctagagcaaattaagtctctggacacaaaattg
aattttgaggtgtacatttccctctcatgccacaactgtccagacgtggtgcaagccgtc
aacttgatggcggtactaaaccctaacatcaccgcgaccatgatagatggctctatgttc
caagacgaagtgaacgagcgcaacatcatggccgtgccttcagtgtacctaaatggcgaa
ttattcggccaaggtcgcatgacattagcggaaatcgttaacaaagtagacactggcgcc
gctgacaaacaagccgccgcattggctgaaaaagcgccctacgacatgttagttgttggt
ggtggtccagctggcgcagccgccgctatttatgccgctcgtaaaggcatccgcacaggt
gtcgtggcagaacgttttggtggtcaagtcagtgataccatggccattgaaaactttatt
tccgtcaaagccacagacggtccaaaattggtcgcaggtcttgagcaacacgtattagat
tacgatgtggatctaatgaaattgcaaaaagccgttcgcctcgaaaagaaagaattcatc
gaagtggaattggaaaacggtgccattctacaaagtaaatctgtggtattagcgacgggc
gcacgctggagagaaatgaatgtgccaggtgaacaagaataccgaaacaaaggcgttgct
tactgcccacactgtgatggtccattgttcaaaggcaaaaagacagccgttatcggtggt
ggtaactcaggcattgaagcggcaatcgaccttgctggcatcacagagcacgtgaccgta
ctggaatttagtgacaccttacgtgccgacgatgtattggtgaaaaaagcgcaatccttg
ccaaatgtcaccatcatcaaaaacgcgatgaccacagaagtcatgggagatggacaacga
gtaatcggcctaaaatacacagatcgattaaccgacgagtctcaccttgtcgacgtggcc
ggcatcttcgtacagattggcttggtgccaaacagtgagttcttgaaggaaacattggag
ctgagcaaccgtggtgaaatcatcgttaatgctcatggcgaaacctctatcccaggtgta
tttgccgctggtgatgtgaccaccgcaccttacaagcaaattgtcatctccatgggttct
ggtgcaacggctgctcttggtgcatttgattacttgattcgtaactag

DBGET integrated database retrieval system