KEGG   Marinomonas sp. MWYL1: Mmwyl1_3120Help
Entry
Mmwyl1_3120       CDS       T00567                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00630  Glyoxylate and dicarboxylate metabolism
mmw01100  Metabolic pathways
mmw01120  Microbial metabolism in diverse environments
mmw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mmwyl1_3120
Enzymes [BR:mmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mmwyl1_3120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABR72030
UniProt: A6W001
LinkDB All DBs
Position
complement(3534406..3535632)
Genome map
AA seq 408 aa AA seqDB search
MMDRFEVTYLIHSFISLAQVAEKICNDQTTGTFTKIPDISSRNVGCFSAEVISIEESFVS
SLKQYRGRVIISYPIDLCGYDLSAIFTIACGGVSSIKVIERLKIADIQFTDQFVAHFQGP
KFGIEGTYRKLGMSEGPVIGGILKPNIGITPADSANLVEQLVAAEIDFIKDDEKLQSPPY
SHVKDRIDAIMPVIDDWQQKSGKKVIYAFNICHSDIGEIERNHEYLKSKGGDAAVINVNQ
IGICGLDSINKFSDVILHAHTNGLAFNERSDWGISFNVWQKVWRLLGIDHLQINGIDGKY
WQGNDSVMEAYYAMTQPLGHLSATLPVFCSGQWGGQVPETYNRTGKSTELMYLGGGGIHG
HPLGAQGGVKAIRQAWDSCISGQNIHDYAVTHPELSQALSYFSHKAKQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgatggatagatttgaggttacgtacttaattcatagtttcatcagtttagctcaagtt
gctgagaaaatttgcaatgatcaaacaactggaacttttacgaaaattccagatatctca
agtcgtaatgtgggatgcttttcggctgaagttatttctatagaagaaagctttgtttca
tcattaaagcaatatcgtggtcgtgtgattatctcttaccctattgatttatgcggatat
gacttgtctgctattttcacaattgcttgtggtggggtctcatctattaaggtgattgag
cgtttaaaaatagcagacattcaattcaccgatcaatttgttgctcactttcaaggtcca
aaatttggtattgaaggtacttatcgcaaattgggaatgtcagaaggtccagtgatcggt
gggatcttaaaaccgaatattggtatcacaccagcagacagcgcaaatctggttgaacaa
ctggtggctgctgaaattgatttcattaaagacgatgagaaactacaaagtccgccatac
tctcatgtaaaagatcgcatcgacgctattatgcctgttattgatgattggcagcagaaa
agtggtaagaaagttatttatgcatttaacatttgtcattcagatattggtgaaattgaa
cgtaatcatgagtatttgaaaagcaaaggcggtgatgctgctgttataaacgtcaatcaa
ataggtatttgcggtttagattcaattaataagtttagtgacgttattttgcatgctcat
actaatgggctggcttttaatgagcgcagcgattgggggatttctttcaatgtttggcaa
aaagtttggcgtctattaggcatagatcatcttcaaattaatggtattgatgggaagtat
tggcaaggtaatgattccgtgatggaggcttattatgcaatgactcaacctcttggccat
ttatctgcaactttacctgttttttgctccggtcagtggggtggtcaggtgccagaaacc
tacaatcgaacaggtaaatctacagaactaatgtatctcggcggtggtggtatacatggt
catccattgggtgctcagggtggagtaaaagccattagacaagcttgggattcctgtatc
tcaggtcaaaatatacatgattatgctgtgactcatcctgagttatcgcaggcattatcg
tatttttctcataaagcaaaacaataa

DBGET integrated database retrieval system