KEGG   Marinomonas sp. MWYL1: Mmwyl1_3267Help
Entry
Mmwyl1_3267       CDS       T00567                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00020  Citrate cycle (TCA cycle)
mmw00480  Glutathione metabolism
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
mmw01130  Biosynthesis of antibiotics
mmw01200  Carbon metabolism
mmw01210  2-Oxocarboxylic acid metabolism
mmw01230  Biosynthesis of amino acids
Module
mmw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmwyl1_3267
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mmwyl1_3267
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Mmwyl1_3267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Focal_AT
Motif
Other DBs
NCBI-ProteinID: ABR72172
UniProt: A6W0E3
LinkDB All DBs
Position
3700569..3702791
Genome map
AA seq 740 aa AA seqDB search
MSTKQTIYYTFTDEAPALATASLLPIFGAFAKEADIELKLTDISLASRVIAAFSDRLPAD
KQAEDGLKFLGDLTADPQANIVKLPNISASLPQLNATIKELNAEGYGLPEYPENPQTDEE
KEVQARYSKVLGSAVNPVLRQGNSDRRAPAAVKGYARKNPHSMGKWKKTSISHADYMRDG
DFYSSEQSVTMDSAQTVRLEFVGTDGSVEVKKSLPLLAGEIIDSMNISTKKLRAFFEATM
QEAKEDNIMWSVHLKATMMKVSHPIVFGHAVTVFYKDVFEKYGELFKEIGVNPNNGLGSV
YDKIQSLPEAKQEEIKQAIQDVYKTRPELAMVDSDKGITNLHVPSDVIVDASMPAMIRNS
GKMWGRDGKAHDAKAVIPDSTYARIYQETINFCKTNGAFDPVTMGTVPNVGLMAQKAEEY
GSHDKTYEMKADGVMRVVDANDNILMQHNVEKGDIWRACQTKDAAIRDWVKLGVTRARQS
DTPAVFWLEDERAHDNELRKKVETYLKDHDTSGLDIRIMPYNEAIRFSMERIIRGKDTIS
VTGNILRDYLTDLFPILELGTSAKMLSIVPMLNGGGMYETGAGGSAPKHVQQLMEENYLR
WDSLGEFLAVAVSFEELGIKHNNEKAKILAKCLDKATGKLLDTNKSPSRKVGEIDNRGSH
FYLALYWAQELAAQTEDANLAAKFAPLAKQLADNEDKIVAELAAVQGKPSGLSGYYHMDL
NEVAKIMRPSATFNTALATL
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaaacaaaccatttactatacatttactgatgaggcgccagctctggcaacc
gcgtctttacttcctatctttggcgctttcgccaaagaagcagacatcgaactaaaattg
acagacatatctttggctagtcgtgttatcgctgcgttttctgaccgacttcctgctgac
aaacaagctgaagacggcctaaaattcctaggtgatttaactgctgaccctcaagcgaat
atcgttaaactacctaacatcagtgcgtcactacctcaacttaatgcgacaattaaagaa
ttaaacgcagaaggttatggtcttccagaatacccagaaaacccacaaactgacgaagaa
aaagaagttcaagcacgctactctaaagttcttggtagtgcggtaaacccagttctacgt
caaggtaactctgaccgtcgcgcaccagcagcggtaaaaggttatgctcgcaaaaaccct
cattcaatgggcaaatggaaaaaaacttctatttcacatgctgattacatgcgtgatggt
gatttttactcttctgagcaatctgtcactatggattcggcgcaaacagttcgcctagag
ttcgttggtacagatggctccgttgaggtgaaaaagtcacttcctctactagctggtgaa
atcatcgatagcatgaacatcagcaccaaaaagcttcgcgctttctttgaagcgacaatg
caagaagcaaaagaagacaacatcatgtggtctgtgcaccttaaagcaaccatgatgaaa
gtgtctcaccctatcgtatttggtcatgctgtaacggttttctacaaagacgtttttgaa
aaatacggtgagcttttcaaagaaatcggcgtaaacccaaacaacggtttaggtagcgta
tacgacaagatccaaagccttccagaagcgaaacaagaagagatcaaacaagcaatccaa
gacgtttataaaactcgtcctgaattagctatggttgattctgataaaggcatcactaac
ctacacgtaccaagtgacgttatcgttgatgcctctatgccagctatgatccgtaattct
ggtaaaatgtggggccgtgatggcaaagcacacgacgctaaagccgtcattccagacagc
acttacgctcgtatttaccaagaaactatcaacttctgcaaaaccaatggcgcattcgac
ccagtgacaatgggtactgtgccaaacgttggcctaatggctcaaaaagcagaagaatac
ggctcgcatgacaaaacatacgaaatgaaagctgatggcgttatgcgcgttgtggatgca
aacgacaatatcttgatgcaacacaatgttgaaaaaggcgatatttggcgcgcttgtcaa
actaaagatgcggcgattcgcgactgggtgaaactaggtgttactcgagctcgtcaatct
gacactccggctgtattttggctagaagacgaacgcgcacacgataacgaacttcgtaaa
aaagtagaaacttacctaaaagaccacgatacaagcggtctagacattcgcatcatgcct
tacaacgaagcaatccgtttctctatggaacgtattattcgtggtaaagacactatttca
gtaacaggtaacattctacgtgactacctgactgacttgttcccaattttggaactaggc
acctctgctaaaatgttgtctatcgtaccaatgctaaatggcggtggtatgtatgaaact
ggtgcgggcggttctgctcctaagcacgttcaacagcttatggaagaaaactaccttcgt
tgggactctctaggtgaattccttgctgtagccgtttctttcgaagagcttggcatcaag
cacaacaacgaaaaagcgaaaatacttgctaagtgcctagataaagcaactggcaaattg
ttagatactaacaagtctccttctcgtaaagttggcgaaatcgacaaccgcggtagtcat
ttctacctagcactttactgggctcaagaacttgcagcgcaaactgaagatgctaatttg
gcagctaaattcgctcctcttgctaagcagttagccgataacgaagataagatcgttgct
gaacttgcggcagtacaaggcaagccttctggtctatctggttattaccacatggacctg
aacgaagtggctaagatcatgcgtcctagcgcaacgttcaataccgctctagcgacactt
taa

DBGET integrated database retrieval system