KEGG   Methanococcus maripaludis C6: MmarC6_0723Help
Entry
MmarC6_0723       CDS       T00615                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00790  Folate biosynthesis
mmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MmarC6_0723
Enzymes [BR:mmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     MmarC6_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2 HD_2
Motif
Other DBs
NCBI-ProteinID: ABX01540
UniProt: A9A867
LinkDB All DBs
Position
661248..661934
Genome map
AA seq 228 aa AA seqDB search
MNDLIALAEGIKNEKLKKQVLEFINDPIPKHPEIESTGITIENSPASVKRHHKYPGGLIE
HTVAVTKMAVKMAEALEETYGIELNRDLLISGGILHDLMKPQNYQLKDGKFDHLSDFHLD
HLTLGIAELYRRDFPLEVIKVVASHHGDHGPVSPDSIEAWLIHHADNVDAAINDIGIRIC
QARAREFGIDDAQIYKITNPLKLYEMRKKLGKDKVKEFLKEKLGIKDE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatctgatcgctcttgcagaaggaattaaaaacgaaaaattaaaaaaacaggtt
ctcgaatttataaacgatccgatcccaaaacatcctgaaattgaaagtactggaataaca
attgaaaactctccagcaagcgttaaacgacatcacaaataccctggaggattaatcgaa
catacagttgcagttacgaaaatggctgtaaaaatggctgaagctctggaagaaacctat
ggaatagaattaaatagagatttactaatttctggaggaatacttcacgatcttatgaaa
ccgcaaaattaccagttaaaagacggaaaattcgaccatctttcagattttcacctcgat
cacctaactctcggaattgcggaactttacagaagggactttccactcgaagttataaaa
gttgtagctagccaccacggagatcacgggcctgttagtccagattcaattgaagcatgg
ctaattcatcatgcagacaatgtagatgccgcaattaatgacataggaattagaatatgt
caagcaagagccagagagtttggaattgatgatgcgcaaatttataaaatcaccaatcca
ttaaaattatatgagatgcgtaaaaaattgggaaaagataaagtaaaagaatttttaaag
gaaaaattaggaataaaagatgaataa

DBGET integrated database retrieval system