KEGG   Methanococcus maripaludis C6: MmarC6_1160Help
Entry
MmarC6_1160       CDS       T00615                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx01100  Metabolic pathways
mmx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MmarC6_1160
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MmarC6_1160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mmx01011]
    MmarC6_1160
Enzymes [BR:mmx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MmarC6_1160
Peptidoglycan biosynthesis and degradation proteins [BR:mmx01011]
 Precursor biosynthesis
  Racemase
   MmarC6_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABX01973
UniProt: A9A9F0
LinkDB All DBs
Position
1088908..1090029
Genome map
AA seq 373 aa AA seqDB search
MVSHPIWAEIDLSAIKNNIKEIRRITNPKSQVMAVVKANAYGHGAIEVSKVCLENGADRL
AVARSTEALELRNAGITCPILVFGYCTEEEIEKMVENDIILTVYSLETANSIQKIAEKLG
EHPKIHIKLDTGMSRLGFLPEKEAVEAIQKIMELKNIEVEGIYTHFADADNSDKTYTTMQ
FSRFTNFLHDLEENEIFIPIKHASNSAAIIDHPETHLNLVRPGIILYGLYPSELVHKERI
DLKPAMSLKVLVTHVKEVPENTKISYGCTFETKKPSKIASLPIGYADGFTRMLKDGYVLI
HGSRVPVIGRICMDQCMIDVSDIENVQVGDVVTIFGTQEHEKIPIEEFGEKLGTINYELV
CMVANRVPRKYLQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtttcacatccgatctgggcagaaattgacttaagcgcaattaaaaacaatattaaa
gaaataagaagaatcacaaaccccaaatctcaggtaatggcggtagtaaaggcaaacgct
tatgggcacggtgcaatcgaagtttcaaaagtatgtcttgaaaatggggctgatagactt
gcagtcgcacgttcaactgaagctcttgaattgagaaatgccggaataacctgtcccata
ctggtatttggctactgtactgaagaagaaatcgaaaaaatggttgaaaatgatataatt
ttaacagtttattcattagaaactgcgaattcaattcaaaaaattgccgaaaaattagga
gaacatccaaaaatccatattaaattagatactggaatgagtagacttggatttttgccc
gaaaaagaagctgtagaagccatacaaaaaattatggaactcaaaaatattgaagttgaa
ggaatttacacgcattttgctgatgcggataattctgataaaacatacactacaatgcaa
ttttcaagatttacaaatttcttacacgatctcgaagaaaatgaaatttttattccgata
aaacatgcatcaaacagcgctgcaataattgatcaccctgaaacacatctcaatctagta
aggcccggaattatcctttatggactttacccctcagaattagtccataaggaacggatc
gatttaaaacctgcaatgagtttgaaagtactcgtaactcacgtaaaagaagttccagaa
aacacgaaaataagttatggatgcacatttgaaaccaaaaaaccctcaaaaattgcttca
cttcccataggctatgctgatggatttacaagaatgctaaaggacggatacgtcttaatt
cacggatcaagggttcctgttattggtagaatatgtatggaccagtgcatgatcgatgtt
tcagatattgaaaatgtccaagtgggggacgttgttacgatatttggaactcaggaacat
gaaaaaatcccaattgaagagtttggtgaaaaattgggaaccataaattatgaactcgtt
tgtatggtggcaaacagagttccaagaaaatacttacaataa

DBGET integrated database retrieval system