KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0185Help
Entry
MSC_0185          CDS       T00161                                 

Definition
(RefSeq) restriction endonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Brite
KEGG Orthology (KO) [BR:mmy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mmy02048]
    MSC_0185
Enzymes [BR:mmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     MSC_0185
Prokaryotic defense system [BR:mmy02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    MSC_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI
Motif
Other DBs
NCBI-GeneID: 2744354
NCBI-ProteinID: NP_975188
UniProt: Q6MU56
LinkDB All DBs
Position
219986..220579
Genome map
AA seq 197 aa AA seqDB search
MLGMNAYDVIYKKIKEIANKYSNKLNSQFQKRIVEMQNDDKSHHLIYRVLGIPYDVGNEI
DYYQNQVRFLYKYAGSFLEEVTILCFKEKYPFASKTKVKNTISNIPKTFEIDCLVNNNAY
EIKWRDATTDNDHIIKEHTRVKTLISYNYKPIRIMFYYPNRVNSMRIQETLETLYKGVGG
EYYYGDSAWSYVKKLQE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgttgggtatgaatgcttatgatgttatttacaagaaaataaaggaaatagcaaataaa
tatagtaacaaacttaatagtcaatttcaaaaacgtattgttgaaatgcaaaatgatgat
aaatctcaccatttaatctatagagttttaggaataccctatgatgttggaaatgaaatt
gattattatcaaaatcaagttcgttttttatataaatatgcaggttcttttttagaagaa
gtgacaattttatgttttaaggaaaaatatccatttgcttctaagacaaaagttaaaaat
acaatttctaatataccaaaaacttttgaaatcgattgtcttgtaaataataatgcttat
gaaattaaatgaagagatgctactactgataatgatcatataattaaagaacatactaga
gtaaaaacattaatatcttataattataaaccaattagaataatgttttactatccaaac
agagtcaattctatgagaattcaagaaacattagaaacattatataaaggtgtaggtggt
gagtattactatggtgattctgcttgaagttatgtaaaaaaactacaggagtag

DBGET integrated database retrieval system