KEGG   Mycoplasma mycoides subsp. mycoides izsam_mm5713: mycmycITA_00205Help
Entry
mycmycITA_00205   CDS       T03541                                 

Definition
(GenBank) ApaLI-like restriction endonuclease
Organism
mmyi  Mycoplasma mycoides subsp. mycoides izsam_mm5713
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI
Motif
Other DBs
NCBI-ProteinID: AIZ55035
UniProt: A0A0F2BM37
LinkDB All DBs
Position
230982..231566
Genome map
AA seq 194 aa AA seqDB search
MNAYDVIYKKIKEIANKYSNKLNSQFQKRIVEMQNDDKSHHLIYRVLGIPYDVGNEIDYY
QNQVRFLYKYAGSFLEEVTILCFKEKYPFASKTKVKNTISNIPKTFEIDCLVNNNAYEIK
WRDATTDNDHIIKEHTRVKTLISYNYKPIRIMFYYPNRVNSMRIQETLETLYKGVGGEYY
YGDSAWSYVKKLQE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttatgatgttatttacaagaaaataaaggaaatagcaaataaatatagtaac
aaacttaatagtcaatttcaaaaacgtattgttgaaatgcaaaatgatgataaatctcac
catttaatctatagagttttaggaataccctatgatgttggaaatgaaattgattattat
caaaatcaagttcgttttttatataaatatgcaggttcttttttagaagaagtgacaatt
ttatgttttaaggaaaaatatccatttgcttctaagacaaaagttaaaaatacaatttct
aatataccaaaaacttttgaaatcgattgtcttgtaaataataatgcttatgaaattaaa
tgaagagatgctactactgataatgatcatataattaaagaacatactagagtaaaaaca
ttaatatcttataattataaaccaattagaataatgttttactatccaaacagagtcaat
tctatgagaattcaagaaacattagaaacattatataaaggtgtaggtggtgagtattac
tatggtgattctgcttgaagttatgtaaaaaaactacaggagtag

DBGET integrated database retrieval system