KEGG   Mycoplasma mycoides subsp. mycoides SC Gladysdale: MMS_A0212Help
Entry
MMS_A0212         CDS       T02595                                 

Definition
(GenBank) ApaLI-like restriction endonuclease
Organism
mmym  Mycoplasma mycoides subsp. mycoides SC Gladysdale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI
Motif
Other DBs
NCBI-ProteinID: ADK69080
LinkDB All DBs
Position
230981..231565
Genome map
AA seq 194 aa AA seqDB search
MNAYDVIYKKIKEIANKYSNKLNSQFQKRIVEMQNDDKSHHLIYRVLGIPYDVGNEIDYY
QNQVRFLYKYAGSFLEEVTILCFKEKYPFASKTKVKNTISNIPKTFEIDCLVNNNAYEIK
WRDATTDNDHIIKEHTRVKTLISYNYKPIRIMFYYPNRVNSMRIQETLETLYKGVGGEYY
YGDSAWSYVKKLQE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttatgatgttatttacaagaaaataaaggaaatagcaaataaatatagtaac
aaacttaatagtcaatttcaaaaacgtattgttgaaatgcaaaatgatgataaatctcac
catttaatctatagagttttaggaataccctatgatgttggaaatgaaattgattattat
caaaatcaagttcgttttttatataaatatgcaggttcttttttagaagaagtgacaatt
ttatgttttaaggaaaaatatccatttgcttctaagacaaaagttaaaaatacaatttct
aatataccaaaaacttttgaaatcgattgtcttgtaaataataatgcttatgaaattaaa
tgaagagatgctactactgataatgatcatataattaaagaacatactagagtaaaaaca
ttaatatcttataattataaaccaattagaataatgttttactatccaaacagagtcaat
tctatgagaattcaagaaacattagaaacattatataaaggtgtaggtggtgagtattac
tatggtgattctgcttgaagttatgtaaaaaaactacaggagtag

DBGET integrated database retrieval system