KEGG   Maritalea myrionectae: MXMO3_00194Help
Entry
MXMO3_00194       CDS       T05588                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
mmyr  Maritalea myrionectae
Pathway
mmyr00061  Fatty acid biosynthesis
mmyr01100  Metabolic pathways
mmyr01212  Fatty acid metabolism
Module
mmyr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mmyr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MXMO3_00194
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmyr01004]
    MXMO3_00194
Enzymes [BR:mmyr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     MXMO3_00194
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     MXMO3_00194
Lipid biosynthesis proteins [BR:mmyr01004]
 Fatty acid synthase
  Component type
   MXMO3_00194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AVX02742
UniProt: A0A2R4M9Q4
LinkDB All DBs
Position
complement(205652..206164)
Genome map
AA seq 170 aa AA seqDB search
MTERAHQFSYDDLILHGRGELPGQGDAKLPAPPMLMFDRITNIDSDGGEYSKGSVTAELD
LNPDLWFYQCHFIGDPVMPGCLGLDALWQMIGFFLSWSGSPGRGRALGGAIKFVGQATND
KKLLQYHVDIKKHMRSPLPFGVANGWVKADGEIIYKAENLRVGLIGLEDK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcgcgcccatcagtttagttacgatgatttgattttgcatggacgcggcgag
ctgccagggcaaggcgacgccaaattgcctgcgccgccaatgttgatgtttgatcgcatc
accaacatcgattccgatggcggtgaatactcaaaaggcagcgtaacagccgaattggat
ttgaaccctgatttgtggttctatcaatgccactttatcggcgatccagttatgccgggc
tgtttgggccttgatgcgttgtggcaaatgattggctttttcttgtcatggtccgggtct
cccggccgcggacgtgccctaggcggtgccatcaagtttgttggccaagccacaaatgac
aaaaaattgctgcaatatcatgttgatattaaaaagcacatgcggtctccgttgcccttt
ggcgttgccaatggctgggtcaaggcagacggtgagatcatttacaaagccgaaaacttg
cgcgtgggcttgatcggccttgaagacaaatag

DBGET integrated database retrieval system