KEGG   Maritalea myrionectae: MXMO3_00659Help
Entry
MXMO3_00659       CDS       T05588                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
mmyr  Maritalea myrionectae
Brite
KEGG Orthology (KO) [BR:mmyr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    MXMO3_00659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AVX03192
UniProt: A0A2R4MB07
LinkDB All DBs
Position
complement(650805..651665)
Genome map
AA seq 286 aa AA seqDB search
MGITETRISPLKTAIGRWWNNDPFTQSAAVAFYTIFSFPALIILYLGLASMFMQEDAVRM
QVFGFLRANFGADAAETFRTIVANTAPSEKSFIPFIFAGTVLVYAALRLFLQLQKALNYI
WDIDDSKVSNFQALVLRRLISFAVMMGVLFVLAVSLVITSTISSLTDWIIDHLPDMFAVL
AHSVNLILSLTIISLLFAVILKILPDRNVSWSHVAPGALLAAALFMLGEYGMGLYFGWVK
PGSAYGVTGSIILLMIWVFYSSAVFLLGAEYAKTLHQKSLVRKNAS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcactgaaacaagaatatcgccgctaaagacggctattgggcgctggtggaac
aatgatccgttcacccagagcgccgctgtggccttctatacgattttttctttccctgcc
ctgatcattctctatctgggcttggcgtcaatgtttatgcaagaagacgccgtacgcatg
caggtgtttggctttttgcgcgccaatttcggcgccgacgctgccgagaccttccggaca
atcgttgccaacacggcaccatcagagaaaagtttcatccccttcattttcgcgggtaca
gtgctcgtctatgccgcattgcggctttttttacagctgcaaaaggcgctcaactatatt
tgggacattgacgacagcaaagtgtcaaactttcaggcgctggtgctacggcgtctcatt
tccttcgcggtcatgatgggcgtgctttttgtccttgccgtttctttggtgatcacctcg
accatcagctcattgaccgattggatcatcgaccacctgccagatatgtttgcggtgctg
gcgcacagcgtcaatctgatcctgtcgctcaccatcatcagcttgctgttcgcagttatc
cttaaaatactgcccgaccgtaacgtcagctggtcgcacgtcgcccccggcgcgctcctc
gctgcggccctgttcatgttgggcgagtatggcatgggattgtattttggctgggttaag
cccggctccgcttatggcgtcactgggtcaatcattttgctgatgatttgggtgttttat
tccagcgccgttttcctgctcggcgcagaatatgcgaagaccctgcatcagaaatcgctg
gtgcgcaaaaacgccagttaa

DBGET integrated database retrieval system