KEGG   Maritalea myrionectae: MXMO3_02813Help
Entry
MXMO3_02813       CDS       T05588                                 

Definition
(GenBank) UPF0721 transmembrane protein
  KO
K07090  uncharacterized protein
Organism
mmyr  Maritalea myrionectae
Brite
KEGG Orthology (KO) [BR:mmyr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MXMO3_02813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AVX05324
UniProt: A0A2R4MHG9
LinkDB All DBs
Position
complement(2760185..2760958)
Genome map
AA seq 257 aa AA seqDB search
MEYEISLLVIMAGVAFVAGFMDAIAGGGGLISVPALLFAGLPPVGALATNKMQSVVGAVV
AATTYARKGYVDFKQLGVAIITTFVGSMIGAFGATQMDTDILLVLVPILLIGVAAYFLFS
PRLSDDARAERLNFALFAPLMGFTIGFYDGIFGPGTGSFFTAGFVTLFGFGVTRAVGSTK
VLNATSNAAALVFFIYAGEVIWAVGGAMIVGQFGGGYLGAITGMRFGAKIIKPMIVIIST
AMAVRLLWPQIIEIFAT
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgaaatctcgctgctggtaatcatggccggcgtcgcctttgttgcgggtttt
atggacgctattgctggtggcggtggactgattagcgtgcccgcgctgttgttcgccggc
ttgccgcctgtgggggctttagcgaccaacaaaatgcaatctgttgtcggcgccgtggtt
gccgccacaacatatgcacgcaaaggctatgtggatttcaagcagttgggcgtcgcgatc
atcaccacatttgtgggcagcatgattggcgcgtttggcgcgacacagatggacaccgat
attttgcttgttctggtgcctattctgctgatcggcgtggcggcgtactttttgttttcg
ccccgtctttcagatgacgcccgcgctgagcggctgaattttgcacttttcgcccctctt
atgggcttcaccatcggcttttatgatggcattttcgggcccggcacgggttcgtttttc
acggccggatttgtcaccctgtttggctttggcgtcacccgcgctgtcggctcaaccaaa
gtgttgaacgcaacgtctaatgcagccgcacttgtgttcttcatttatgcgggcgaagtg
atttgggcagtgggcggtgccatgatcgttggtcagtttggcggaggctatcttggcgcg
atcacgggaatgcgctttggcgcaaagatcatcaagccaatgattgtgatcatatcaacc
gccatggcggtgcgtctgctttggcctcaaatcattgaaatatttgcaacttag

DBGET integrated database retrieval system