KEGG   Methanococcus maripaludis C7: MmarC7_0536Help
Entry
MmarC7_0536       CDS       T00553                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
mmz00500  Starch and sucrose metabolism
mmz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MmarC7_0536
Enzymes [BR:mmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MmarC7_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 HEPN
Motif
Other DBs
NCBI-ProteinID: ABR65604
UniProt: A6VGM8
LinkDB All DBs
Position
complement(542238..543461)
Genome map
AA seq 407 aa AA seqDB search
MLLSLNFEVHQPNRLRKSVNSNSGDLWNRYVDVELNKEIFNKVADKCYIPSNMIMLELID
NYDIEISYSITGVFLEQALEFNEEVVELFRDLAKTGNVEFLGETYHHSLSSLFEEHDEFK
EDILEHKKLIKELFGYKTTTFRNTELIFNNKIAETIKEMGFNGMFTEGTNRILDWRSPNY
VYSSLSGLNVLLRNYNLSDDIGFRFSSRDWKEYPLMADKYANWLSNTPGDCINLYMDYET
FGEHQWYDTGIFEFLRHLPKELDNHNHIEYATPSEIFELCKSKDTIDVFEFSTLSWADSE
RDISAWLGSKMQQLSFQKLKEIRGYLNQYLQQFDEKERKELIEYKIYKNMQTSDNFYYMC
TKGFNDMDVHSYFSHFSTPYDAYAAYLDTYYDFKNHLVLKLLSTYFK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgttgctgtctcttaatttcgaggtccatcaaccgaacaggcttagaaaatctgtaaat
tcaaacagtggggatctttggaaccgctatgtcgacgtagaattaaacaaggaaattttc
aataaagtggcagataagtgctacatcccatcaaatatgataatgcttgaattaatcgat
aattatgatatcgagatatcttacagcattacgggtgtttttttagagcaggctctcgaa
tttaatgaagaagtcgttgaattattcagagatttagcaaaaactggaaatgtggaattt
ttaggtgaaacttaccaccattcattatcgagtctttttgaagaacacgacgaatttaaa
gaagatattctcgaacataaaaaactgataaaagaactttttggatacaaaacaacgact
tttagaaataccgaactgatttttaacaacaaaattgcggaaacgattaaagaaatggga
tttaacggaatgtttaccgaaggcactaaccgtattttagactggaggtcgccaaattac
gtttacagctcattaagtggattaaatgtacttcttagaaattacaatttaagcgatgat
ataggatttagattttcttcgagagactggaaagaatacccgttaatggctgataaatat
gcaaactggctttcaaatactcctggagattgtataaatttatacatggattatgaaacg
tttggagagcaccagtggtatgataccggaatttttgaatttttaaggcaccttccaaaa
gaactggataaccacaaccacatcgaatatgcaacgccttctgaaatttttgaattatgc
aaatcaaaagatactatcgatgtttttgaattttcaaccctttcatgggcagattcagaa
agagacattagtgcatggcttggaagtaaaatgcagcagttatcattccagaaattaaaa
gaaataagaggatatctaaaccagtacttacagcaatttgatgaaaaagagcgaaaagag
ttaatagaatataaaatctataagaacatgcagactagtgataatttttactatatgtgc
acaaaaggttttaatgacatggatgtacactcttatttcagtcatttttcaacgccgtat
gatgcatatgcagcatatttagacacatattatgattttaagaatcatctagttttaaaa
ttactttcaacatatttcaagtaa

DBGET integrated database retrieval system