KEGG   Methanococcus maripaludis C7: MmarC7_0758Help
Entry
MmarC7_0758       CDS       T00553                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
mmz01100  Metabolic pathways
mmz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MmarC7_0758
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MmarC7_0758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mmz01011]
    MmarC7_0758
Enzymes [BR:mmz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MmarC7_0758
Peptidoglycan biosynthesis and degradation proteins [BR:mmz01011]
 Precursor biosynthesis
  Racemase
   MmarC7_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABR65825
UniProt: A6VH99
LinkDB All DBs
Position
complement(740461..741582)
Genome map
AA seq 373 aa AA seqDB search
MVSHPIWAEIDLSAIKNNIQEIRRITNPKSQVMAVVKANAYGHGAIEVSKVCLENGADRL
AVARSTEALELRNAGITCPILVFGYCTEEEIEKMVENDITLTVYSFETAESIQKIAEKLG
KHSKIHIKVDTGMGRLGFLPKKEAIETIKKIMELKNIKIEGIYTHFADADNSDKSYTTMQ
FSRFTNFLHNLEENEIFIPIKHASNSAAIIDHPETHLNLVRPGIILYGLYPSELVHKERI
NLKPAMSLKVLITHVKEVPENTKISYGCTFETKKPSKIASLPIGYADGFTRMLKDGYVLI
HGSRVPVIGRICMDQCMIDVSDIENVQVGDVVTIFGTQENEKIPIEEFGEKLGTINYELV
CMVAGRVPRKYLP
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtttcacatccgatctgggcagaaattgatttaagcgcaattaaaaacaatatccaa
gaaataagaagaattacaaaccccaaatcccaggtaatggcagtagtaaaggcaaacgct
tatgggcacggtgcaatcgaagtttcaaaagtatgtcttgaaaatggggccgatagactt
gcagtcgcacgttcaaccgaagctcttgaactgagaaatgcaggaataacgtgccctata
ctcgtatttggttattgcactgaagaagaaattgaaaaaatggttgaaaatgatataact
ttgacagtttattcatttgaaactgcagaatcaattcaaaaaattgctgagaaattagga
aaacattcaaaaatccatatcaaagtagatactggaatgggaaggcttggatttctgccc
aaaaaagaagctatagaaaccataaaaaaaatcatggaacttaaaaatatcaaaattgaa
ggaatttacacgcattttgcggatgccgacaattccgataaatcatataccacaatgcaa
ttttcaagatttacgaatttcttacacaatcttgaagaaaatgaaatttttattccaata
aaacacgcatcaaatagcgctgcaataattgatcaccccgaaacacatctcaatctagta
aggcccggaattatcctttatggactttacccctcagaattagtccataaagaacgaatt
aatttaaaacctgcaatgagtttgaaggtacttataactcacgtaaaagaagttccagaa
aacacaaaaataagttatggatgcacatttgaaaccaaaaaaccctcaaaaattgcttca
ctgccaataggctatgccgatggatttacaagaatgttaaaggatggatacgtcttgatt
cacggatcaagagttccagttattggtagaatctgtatggatcagtgcatgatcgatgtt
tcagatattgaaaatgtccaagtgggggacgttgttacaatatttggaactcaggaaaac
gaaaaaatcccaattgaagaatttggagaaaaattgggaaccataaattatgaactcgta
tgtatggtggcaggtagggttccaagaaaatacctgccataa

DBGET integrated database retrieval system