KEGG   Methanococcus maripaludis C7: MmarC7_1374Help
Entry
MmarC7_1374       CDS       T00553                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mmz  Methanococcus maripaludis C7
Brite
KEGG Orthology (KO) [BR:mmz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MmarC7_1374
Enzymes [BR:mmz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MmarC7_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M DUF1617
Motif
Other DBs
NCBI-ProteinID: ABR66437
UniProt: A6VJ11
LinkDB All DBs
Position
complement(1335958..1337142)
Genome map
AA seq 394 aa AA seqDB search
MDKMYLSDDILNFEEFIVNASKRLNIDEDTLKNGFSRKLITKYEYNEKKYLCFKKKLKHI
ERGTILFLNNNLDFIQGYPKIRRAMVLESSVEKYFDGKIAVEEKLDGYNIRIVKFYGETI
AITRGGKICPFTTKKVKKYINTKFLDDFPELMLCGEMVGLNNPYVSHYYPEADKNHENLG
FYIFDIRDKETNTALSIYEKERILDEYNISYVKPIKIIDSSDFEELWNILNSLNENHREG
VVLKDPEMLKNPIKYTTHNTQCGDLSVAFSYVYDLGIDFMFSRLVREGYQSFEKCESEEE
MKKRAHDLGESILIPMVETITEISKEGLAKECFELCFDSEKDFEEFINYLKTMHINFAIE
SKEYIKKDVFKSKICRIYNSTSDKIKSHLEGNLW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaatgtatctttcagatgatattttaaattttgaagaatttatagtaaatgcg
tccaaaagattaaatattgacgaagataccttaaaaaatggattcagtagaaaattaatt
accaaatatgaatataacgaaaaaaaatatctgtgttttaaaaagaagttgaaacatata
gaacggggaactattctttttttaaataataatttagattttatccagggttatccaaaa
ataaggcgtgccatggttcttgaatcatctgttgaaaaatattttgatggtaaaattgca
gtagaagaaaaattagacggatataatattagaatcgtaaaattttacggtgaaactatt
gcaattacccgtggcggaaaaatctgccctttcacaaccaaaaaagtgaaaaaatacata
aatacaaaatttttagacgattttcctgaattaatgctctgtggtgaaatggttggatta
aataacccttatgttagccattactatcctgaagccgataaaaatcatgaaaacctcgga
ttttatattttcgatataagggataaggaaaccaatactgccctttcaatttatgaaaag
gaaagaatcctggatgaatataatatttcttatgtaaaaccgataaaaatcatcgatagt
tcagattttgaagaattatggaatattttaaacagtttaaatgaaaatcatagagaaggg
gttgttttaaaagatcctgaaatgttaaaaaacccgataaaatataccacccacaacaca
cagtgcggagacctttcagttgcattcagctatgtttacgaccttggaattgattttatg
tttagcagacttgtaagagaaggctatcaatcctttgaaaaatgtgaaagcgaagaagaa
atgaaaaaacgtgcacatgatcttggagaatctattttgatcccgatggttgaaaccata
acagaaatttcaaaagagggccttgcaaaagaatgtttcgagctttgttttgattcggag
aaagattttgaagaatttataaactaccttaaaacgatgcacataaattttgcaattgaa
agcaaagaatatattaaaaaagatgtatttaaatccaaaatttgtagaatctacaattca
acgtcagataagattaaaagccatcttgagggcaatttatggtaa

DBGET integrated database retrieval system