KEGG   Miniopterus natalensis: 107523789
Entry
107523789         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 2A14-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523789
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523789
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107523789
NCBI-ProteinID: XP_016050967
LinkDB
Position
Unknown
AA seq 310 aa
MGGNQTWIPEVTLLGFQVEPALELFLLGLFSLFYTLTLVGNGVILGLVCFDRRLHSPMYF
FLSHLAVVDMSYASNNVPKMLANLVSQSRTIAFVPCLMQTYLYLAFAHAECLILVVMSYD
RYVAICHPLHYSVIMSWRVCTALAATSWVFSFLLALVHVVLILRLPFCGPHEINHFFCEI
LSVLRLACTDTRLNQLVIFVACVFILVGPLSLVLVSYTRILFAILRIQSGEGHRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSRHPEEQQKILSLFYSLFNPMLNPLIYSLRNAEVMGAL
RRAVCKERPT
NT seq 933 nt   +upstreamnt  +downstreamnt
atgggaggcaaccagacttggatcccggaagtcaccctgctggggttccaggtggagcca
gccctggagcttttcctgcttgggctcttctcgctcttctataccctcacccttgtgggg
aatggagtcatcctgggccttgtttgctttgatcgtaggcttcactcccccatgtacttc
ttcctctcccacctggccgtggtcgacatgtcctacgcttccaacaacgtccccaagatg
ctggcaaacttagtgagccagagtagaaccatcgcctttgtcccttgccttatgcagact
tacttgtatctggcctttgctcacgcagagtgcctgattttggtggtgatgtcctatgat
cggtacgtggccatctgccaccccctccattactctgtcatcatgagctggagagtgtgc
acggccctggccgccacttcttgggtgttcagcttcctcttggctctggtccacgtggtt
ctcatcctgaggctgcccttctgtgggcctcatgaaatcaaccacttcttctgtgagatc
ttgtctgtcctcaggctggcctgcaccgacactaggctcaaccagctggtcatctttgtg
gcctgtgtgtttatcttagtggggcccctcagcttggtgctggtgtcctacacacgcatc
ctctttgccatcctgaggatccagtctggggagggccacagaaaggccttctccacctgc
tcgtcccacctctgcgtggttgggctcttctttggcagcgccatcgtcatgtacatggcc
cccaaatcccgccaccctgaggagcagcagaagatcctttccctgttttatagccttttc
aaccccatgctgaacccgttgatctacagcctgaggaatgcagaggtcatgggcgccctt
aggagagcagtgtgcaaggagaggccaacttga

KEGG   Miniopterus natalensis: 107523790
Entry
107523790         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 2A12-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523790
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523790
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1201
Other DBs
NCBI-GeneID: 107523790
NCBI-ProteinID: XP_016050968
LinkDB
Position
Unknown
AA seq 320 aa
MGSNQTWITDVILLGFQVDPRLEVLLFGFFSLFYSLTLLGNGVILGLICLDSRLHTPMYF
FLSSLAIIDMSYASNTVPKTLANLVTQKKTISFAPCILQTFLYLAFGILECLILVVMSYD
RYVAICHPLHYSVIMSWRVCTALAATSWVFSFLLALVHVVLILRLPFCGPHEINHFFCEI
LSVLRLACADTRLNQLVIFVACVFILVGPLSLVLVSYTRILFAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSRHPEEQQKILSLFYSLFNPMLNPLIYSLRNSEVKGAL
RRFLGTKRSLGGMVWSILSV
NT seq 963 nt   +upstreamnt  +downstreamnt
atggggagcaatcagacatggatcacagacgttatcctgctgggtttccaggtggaccca
agacttgaagttctcctctttgggttcttctcactgttctacagcctcaccctgctgggc
aacggggtcatcctggggctcatctgcctggactcccggctgcacacccccatgtacttc
ttcctttccagcctggccatcattgacatgtcttacgcttcaaacactgttcccaagacc
ctggcaaatcttgtgacccagaagaaaaccatctcttttgctccatgcattcttcagact
ttcctgtatttggcatttggcatcctagagtgcctgattttggtggtgatgtcctatgat
cggtacgtggccatctgccaccccctccattactctgtcatcatgagctggagagtgtgc
acggccctggccgccacttcttgggtgttcagcttcctcttggctctggtccacgtggtt
ctcatcctgaggctgcccttctgtgggcctcatgaaatcaaccacttcttctgtgagatc
ttgtctgtcctcaggctggcctgcgccgacactaggctcaaccagctggtcatctttgtg
gcctgtgtgtttatcttagtggggcccctcagcttggtgctggtgtcctacacacgcatc
ctctttgccatcctgaggatccagtctggggagggccgcagaaaggccttctccacctgc
tcgtcccacctctgcgtggtcgggctcttctttggcagcgccatcgtcatgtacatggcc
cccaaatcccgccaccctgaggagcagcagaagatcctttccctgttttatagccttttc
aaccccatgctgaacccgttgatctacagcctgaggaactcagaggtgaagggtgccctg
aggaggtttctggggacaaagagatcactgggagggatggtttggagtattctgagtgtg
tga

KEGG   Miniopterus natalensis: 107523793
Entry
107523793         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 2F1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523793
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523793
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107523793
NCBI-ProteinID: XP_016050971
LinkDB
Position
Unknown
AA seq 313 aa
MGRDNLTWVDEFVLLGLSSDRRTQAGLFVLFGAAYLLTLLGNGLLLVTIQLDAQLHLPMY
FFLGHLSVVDICYTSSWVPQMLAHLVLEKKTISFARCGAQLFFSLAFGGTEFLLLAAMAY
DRYLAVCDPLRYVAAMGPRLCVVLAAIPWLMGITNSAVVTAVTIHLPTCGHHVLNHVACE
TLALVRLACVDITLNQVVIVASSMVMLLGPCCLVSLSYAHIVAAILRIRSTGGRRKAFGT
CASHLTVVSMSYGMALVTYMQPRSTASAEQDKLVVLFYAALTPMLNPLIYSLRNKEVRAA
LSRVLLRGSGSKR
NT seq 942 nt   +upstreamnt  +downstreamnt
atggggagggacaacctgacctgggtggacgagtttgtcctactggggctctccagcgac
aggcggacccaggctgggctctttgtcctgtttggggccgcctatctgctgaccctgctg
ggcaacggtctcctcctcgtcaccatccagctggacgcccagctgcacctgcccatgtac
ttcttcctcggccacctctcggtggtggacatctgctacacctccagctgggtcccccag
atgctggcgcacttggtcctggagaagaaaaccatctcctttgcccgatgtggggcccag
ctcttcttctcgctggcctttggggggaccgagttcctgctgctggccgcaatggcttat
gaccgctacctggcggtctgtgaccccctgcgctacgtggcagcaatgggccccaggctc
tgtgtggtgctggctgccatcccttggcttatgggcatcactaattctgcggtggtgaca
gcggtcaccatacacctgcccacctgtgggcaccacgtgctgaaccatgtggcctgcgag
acgctggcactcgtcagattggcctgtgtggacatcaccctcaaccaggtggtcatagtg
gcctccagcatggtgatgctgctggggccctgctgcctggtgtccctgtcctatgcccac
atcgtggctgccatcctgcggatccgctccaccggggggcgccgcaaagccttcgggacc
tgcgcctcccacctcactgtggtctccatgtcctacgggatggccctggtcacctacatg
cagccccgctccacagcctccgccgagcaggacaagctggtggtgctcttctatgctgcg
ctgacccccatgttgaacccgctcatctacagcctgcggaacaaggaggtgcgggctgcc
ctgagccgagttctgctgaggggctctggatcgaagcgttag

KEGG   Miniopterus natalensis: 107523794
Entry
107523794         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 10AC1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523794
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523794
SSDB
Motif
Pfam: 7tm_4 7tm_1 Gaa1
Other DBs
NCBI-GeneID: 107523794
NCBI-ProteinID: XP_016050972
LinkDB
Position
Unknown
AA seq 320 aa
MGCPGNATVPCGFVLQGFSEFPHLRPALFLLLLAGHLATLGGNLLILVAVARVPSRPPML
LFLCQLSAIELCYTLVVVPRSLADLAAPGGDRGRPISFLGCAVQMQLFVALGGAECFLLA
AMAYDRYVAICRPLRYAALVTPGLCARLALACCLGGLTVSVGLTAAVFRLPFCSPRLLVH
FFCDITALLHLACTRGYADELPLLGACLALLLLPAALILASYCAVAAALRRLRSPGGRRK
AASTCASHLAVTFLHYGCATFMYVRPKASYSPRRDRALALVYTNATPLLYPLIYSLRNCE
VTAAVRRVLGRGPGAGSESA
NT seq 963 nt   +upstreamnt  +downstreamnt
atgggctgcccgggcaatgccaccgtgccctgcggctttgtccttcagggcttctccgag
ttcccgcacctgaggcccgcgctcttcctgctgctgctggccgggcacctggccaccctc
ggggggaacctgctcatcctggtggccgtggcccgcgtgcccagccggccgcccatgctg
ctcttcctgtgccagctgtcagccatcgagctgtgctacacgctggtggtggtgccccgc
tccctggccgacctggccgcccccggcggggacaggggcaggcccatctctttcctgggc
tgcgctgtccagatgcagctgttcgtggcgctgggcggggccgagtgcttcctgctggcc
gccatggcctatgaccgctacgtggccatctgccgccctctgcgctatgccgccctggtc
accccgggcctgtgcgcgcggctggccctggcctgctgcctcggggggctcacggtgtcc
gtggggctcacggcggcggtcttccgcctgcccttctgcagcccccgcctgctggtgcac
ttcttctgcgacatcacggcgctgctgcacctggcctgcacccggggctacgcggacgag
ctgcccctgctgggcgcctgcctggcgctgctgctgctgcccgccgcgctcatcctggcc
tcctactgcgccgtggcngccgccctgcgccgcctgcgctcccccgggggccggcgcaag
gccgcctccacctgcgcctcgcacctggccgtcaccttcctgcactacggctgcgccacc
ttcatgtacgtgcggcccaaggccagctactccccgcggcgggaccgcgcgctggcgctc
gtctacaccaacgccacgccgctgctctacccgctcatctacagcctgcgcaactgcgag
gtcaccgcggccgtccgcagggtgctggggcgggggccgggcgcgggctcagagtccgca
tga

KEGG   Miniopterus natalensis: 107523795
Entry
107523795         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 2F1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523795
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523795
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107523795
NCBI-ProteinID: XP_016050973
LinkDB
Position
Unknown
AA seq 311 aa
MGRKNQTWVSEFILLGLSSCWETQVSLFFLFLAMYLVTMLGNFVILFLIRLDSSLNTPMY
FFLGVLSFVDICYTNSTVPQMLVHFLTARKTIPFRSCVLQLCVSLALGGSEFLLLGAMAY
DRYVAVCHPLHYTAIMHGGLCLRLAASCLGAGFMNSLMETAITFQLPLCRNVINHFACET
LAVLRLTCVDISFNMAMVAVSGFLVIMLPCSLVLFSYGHIVAAILRIRSAQGRSKAFGTC
ASHLTVVSMCFGATIFTYLGPRPASSVQQEKMVALFYAVVAPMLNPLIYSLRNKEVMAAL
QKVLEKLRDNR
NT seq 936 nt   +upstreamnt  +downstreamnt
atgggcaggaagaaccagacatgggtgagtgagttcattctcctgggcctgtcaagctgc
tgggagactcaggtctccctcttcttccttttcctggccatgtacctggtgaccatgctg
gggaactttgtcatcctcttccttatcagactggacagcagcctaaacacacccatgtac
tttttcctcggtgtcttgtcatttgtggacatctgttacaccaacagcactgtccctcaa
atgctcgttcatttcctcacagcccggaaaaccatcccattccgcagctgtgtgctccag
ctctgtgtgtccctggcattgggcggctccgagttcctcctgctgggagccatggcctat
gaccgctacgtggcggtgtgccacccgctgcactacacagccatcatgcatggagggctg
tgcctgcggctggctgccagctgcttgggggctggtttcatgaactcactgatggaaacg
gccatcacctttcagctacctttgtgccgtaatgttattaatcactttgcttgcgagacg
ttggctgtgctgaggctgacctgtgtggacatctccttcaacatggccatggtggccgtc
tcaggatttctggtgatcatgcttccctgttccctggtcctcttctcctatggtcatata
gttgctgccattctgcgtattcgctctgcccaggggcgtagcaaagcctttgggacctgc
gcctcccacctcactgtggtgtccatgtgctttggggctaccatcttcacctacctgggg
ccacggccggcttcctcagtgcaacaggagaagatggttgctttattctatgctgtggtg
gcacctatgttgaaccccttgatctacagcctgagaaataaggaagttatggccgctctc
cagaaagttttagagaagctcagagataacagataa

KEGG   Miniopterus natalensis: 107523813
Entry
107523813         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 9A4-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523813
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523813
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx Fuz_longin_1 ATP_bind_1
Other DBs
NCBI-GeneID: 107523813
NCBI-ProteinID: XP_016050988
LinkDB
Position
Unknown
AA seq 314 aa
MVSNRSNAAEFCLLGFPGSEELHHLLFATFIFLYSVTLMGNTVIIAIVCVDKRLRSPMYF
FLSHLSALEILTTSIIIPVMLWGLLLPGVQRISLAGCVAQLFLYLAVGTTEFALLGAMAV
DRYVAVCHPLRYHVIMNSHTCLWVVVVSWLFGFLSEIWPVYATFQLTFCKSNLIDHFYCD
RGQLLKLACDDSLFTEFILFLMAVFIIVGSLIPTVVSYTCIISTILKIPSASGRRKAFST
CASHFTFVVLGYGTCLFLYVKPNQTQAAEYNKIVSLLISVVTPFLSPFIFTLRNDKVKEA
LRDSVKGCCQLVKD
NT seq 945 nt   +upstreamnt  +downstreamnt
atggtgagcaatcgctccaatgctgctgaattctgtctccttggcttccctgggtccgag
gagctgcaccatctcctgtttgctaccttcatcttcctctactcagtgacattaatggga
aacacggtcatcatcgcgattgtctgtgttgataaacgtctgcggtcccccatgtacttc
ttcctcagtcacctctctgccttggagatcctgaccacatccatcatcatccctgtcatg
ctctggggcttgctgctccctggggtgcagagaatatctctggctggatgtgtcgcccag
ctcttcctgtaccttgctgtggggaccacagagtttgcattgctgggagcgatggccgtg
gaccgttacgtggctgtctgtcacccgctgaggtaccacgtcattatgaacagccacacc
tgcctctgggtggtagttgtgtcgtggctgtttgggttcctttctgaaatctggccggtc
tatgccacgtttcagctcaccttctgcaaatcaaacctgatagaccatttttattgtgac
cgagggcagctgctcaaactagcctgtgatgacagccttttcacggagtttattcttttt
ttaatggccgttttcattatcgtcggttctctgatccccacagttgtctcttacacctgc
atcatctccaccatcctcaagatcccctcggcctctggccggaggaaagccttctccacg
tgtgcctcccacttcacctttgtggtgctgggctatggcacctgcctcttcctctacgtg
aagcccaatcagacgcaggcggccgagtacaacaagatagtttccctgctgatctctgtg
gtgacccctttcctgagccctttcatcttcaccctccggaatgacaaagtcaaagaggcc
cttagagatagtgtgaaaggctgctgtcaacttgtcaaggattaa

KEGG   Miniopterus natalensis: 107523814
Entry
107523814         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 2A2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523814
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523814
SSDB
Motif
Pfam: 7tm_4 7tm_1 GlutR_dimer 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107523814
NCBI-ProteinID: XP_016050990
LinkDB
Position
Unknown
AA seq 309 aa
MGGNQSWVTEFILVGFQLSAEVEMFLFWIFSLFYIFSLLANGMIFVLICLDQRLHTPMYF
FLSHLAVIDMSYASNNVPKMLANLVNQKRTISFVPCIVQTFLYLGLAATECLILVVMSYD
RFVAICHPLQYSIIMSWRACMVLVVTSWSCGFVLALIHAILLARLLFCGPQEVNHLFCEI
LSVLKLACVDTWINKVVIFAASVFVLVGPLCLMLVSYTRILWAILNIQSKEGRKKAFSTC
SSHLCVVGLFFGIAMVVYMVPESSQREEKEKILSLFHSLFNPMLNPLIYSLRNAQVKDAL
HRALQTRSM
NT seq 930 nt   +upstreamnt  +downstreamnt
atggggggcaaccagtcatgggtcacagagttcatcctggtgggattccagctcagtgca
gaggtggaaatgttcctcttctggatcttctccctgttctatatctttagtctgctggca
aatggcatgatctttgtactcatatgtctggaccagagactgcacacccccatgtacttc
ttcctctcacacctggctgtcatcgacatgtcctatgcttccaacaatgtccccaagatg
ctggcaaacttagtgaaccagaagagaaccatctcctttgtcccatgcattgtgcagaca
tttctgtatttgggtcttgctgctacggagtgcctgattttggtggtgatgtcctatgat
aggtttgtggccatctgccaccccctccagtactccatcatcatgagctggagagcttgc
atggtcctggttgtcacttcctggtcatgtggctttgtcctggctctgatacatgcgatt
ctccttgcaaggctgctcttctgtgggccccaggaagtaaaccacctcttctgtgagatc
ctgtctgtcctcaagctggcctgtgttgacacatggatcaacaaagtggtcatctttgct
gcttctgtcttcgtcttggttgggcccctctgcttaatgctagtttcctacacacgtatc
ctctgggccatcctaaatatccagtcaaaagagggacgcaaaaaggccttctccacctgc
tcctcccacctctgtgtggttgggctcttctttggcatagccatggtggtttatatggtc
ccagaatccagtcaacgagaggagaaggagaagatactgtccctgtttcacagtctcttt
aacccaatgctgaaccccctcatctacagcctgagaaacgctcaggtgaaggatgccttg
cacagagcactgcagacgaggtccatgtga

KEGG   Miniopterus natalensis: 107523815
Entry
107523815         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 13-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523815
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523815
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107523815
NCBI-ProteinID: XP_016050991
LinkDB
Position
Unknown
AA seq 310 aa
MGGNQTSVTEFLLLGFPLSPGTQMLLFGLFSLFYAFTLLGNGVILGLVWLDSRLHTPMYF
FLSHLAVVDMSYACNTVPQMLVNLLSPAKPISFAGCVTQTFLFLSFAHTECLLLVVMSYD
RYVAICHPLRYAVLVSWRVCINLAVASWTLGVLLALAHTVLLLPLPFCGPQKVNHFFCEI
TALLKLACADTHINEIVVLAGAASVLVGPLSSIVASYVHILRAILKIRSGAGRQKVFSTC
SSHLCVVGLFYGTAIVMYVGPRHGDPMEQKKYLLLFHSLFNPMLNPLIYSLRNRDVKAAL
KRVLDKERSA
NT seq 933 nt   +upstreamnt  +downstreamnt
atggggggaaaccagacttctgtcaccgagttcctcctgctggggtttcccctgagccca
gggactcagatgctcctcttcgggctcttctccctgttctacgccttcaccctgctgggc
aacggggtcatcctggggctcgtctggctggactcccgcctgcacacccccatgtacttc
ttcctctcacacctggctgtcgtcgacatgtcctacgcctgcaacacggtgccccagatg
ctggtaaacctcctgagcccagccaaacccatctcctttgctggctgcgtgacacagacc
ttcctcttcttgagctttgctcacactgaatgtcttctcctggtggtgatgtcctatgac
cggtatgtggccatctgccaccccctccgatatgctgtcctcgtgagctggagagtctgc
atcaacctggcagtggcttcctggacgttaggggtcctcctggccctggcacatacagtg
ttactcttaccgttgcccttctgtgggccccagaaagtgaatcactttttctgcgagatt
acagctcttctcaagcttgcctgtgcggacacccacattaatgagattgtggttttggct
ggggcagcgtctgtgctggtgggaccgctgtcctccatcgtggcttcctacgttcacatt
ctccgggccatcctgaagatccggtcaggggccgggcgccagaaagtcttctccacctgc
tcgtcccacctctgcgtggttgggctcttttatggcacagccattgtcatgtatgttggg
ccccgacatggggaccccatggagcagaagaaatatctcctcctgttccacagccttttc
aaccccatgcttaaccccctgatctatagtctgaggaacagagacgtcaaagctgccctg
aagagggtgcttgacaaggagagatctgcatga

KEGG   Miniopterus natalensis: 107523823
Entry
107523823         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor-like protein OLF3
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523823
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523823
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107523823
NCBI-ProteinID: XP_016050997
LinkDB
Position
Unknown
AA seq 317 aa
MGTDNQTWVREFILLGLSSDWDTQASLFVLFSVTYMVTVLGNFLIVLLIRLDSRLHTPMY
FFLTNLSLVDVSYATTIVPQMLVHFLAEHKAIPLESCAAQLFFSLGLGGIEFVLLAVMAY
DRYVAVCDPLRYLVIMHGGLCTKLAITSWVSGSVNSLVHTAITFQLPMCSNKFIDHISCE
ILAVVRLACVDTSSNEITIMVSSIVLLMSPFFLVLLSYIRIISTILKIRSTEGRKKAFHT
CASHLTVVVLCYGMAIFTYIQPHSGPSALQEKLISVFYAILMPLLNPMIYSLRNKEVKGA
WQKLSGQLSGLTSKLAT
NT seq 954 nt   +upstreamnt  +downstreamnt
atgggaacagataaccagacgtgggtgagagagtttattcttcttggcctgtccagtgac
tgggacactcaggcctctctctttgtcctcttctccgtcacatacatggtgacagtgctg
gggaacttcctcattgttcttctgatcagattggacagccgactccacacccccatgtat
ttctttctcaccaacctctcccttgttgatgtctcttatgccacaaccattgtccctcag
atgctggttcacttccttgcagaacacaaagcaatcccactcgagagctgtgcggcccag
ttatttttctccctggggttgggtgggattgagtttgttctactggcagtgatggcctat
gaccgctatgtggctgtgtgtgatcccttgcgctacttggtcatcatgcatggagggctc
tgtactaagctggccatcacatcctgggtcagtggctctgtcaactctcttgtgcatact
gccatcaccttccagctgcccatgtgctccaacaagtttattgatcacatatcctgtgaa
atcctagctgtggtcagactggcctgtgtggacacctcttccaatgagatcacaatcatg
gtttctagtattgtcctgctgatgtcaccattcttcctggttctgttgtcctacatcagg
atcatttccaccatcctaaagatcaggtccacagagggaagaaagaaagccttccacacc
tgtgcctctcacctcacagtggttgtcctgtgctatggcatggccatcttcacttacatc
cagccccactctggcccctcagcccttcaggagaagttgatctctgttttctatgccatt
ttgatgcccttgttgaaccccatgatttatagcctaaggaataaggaggtgaagggggcc
tggcagaaactatcagggcaactatctggattaacatcaaaactggcaacttga

KEGG   Miniopterus natalensis: 107523824
Entry
107523824         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor-like protein OLF3
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523824
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523824
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107523824
NCBI-ProteinID: XP_016050998
LinkDB
Position
Unknown
AA seq 317 aa
MGTDNQTWVREFILLGLSSDWDTQASLFVLFSVTYMVTVLGNFLIVLLIRLDSRLHTPMY
FFLTNLSLVDVSYATTIVPQMLVHFLAEHKAIPLESCAAQLFFSLGLGGIEFVLLAVMAY
DRYVAVCDPLRYLVIMHGGLCTKLAITSWVSGSVNSLVHTAITFQLPMCSNKFIDHISCE
ILAVVRLACVDTSSNEITIMVSSIVLLMSPFFLVLLSYIRIISTILKIRSTEGRKKAFHT
CASHLTVVVLCYGMAIFTYIQPHSGPSALQEKLISLFYAILTPMLNPMIYSLRNKEVKGA
WQKLSGQLSGLSSKLAT
NT seq 954 nt   +upstreamnt  +downstreamnt
atgggaacagataaccagacgtgggtgagagagtttattcttcttggcctgtccagtgac
tgggacactcaggcctctctctttgtcctcttctccgtcacatacatggtgacagtgctg
gggaacttcctcattgttcttctgatcagattggacagccgactccacacccccatgtat
ttctttctcaccaacctctcccttgttgatgtctcttatgccacaaccattgtccctcag
atgctggttcacttccttgcagaacacaaagcaatcccactcgagagctgtgcggcccag
ttatttttctccctggggttgggtgggattgagtttgttctactggcagtgatggcctat
gaccgctatgtggctgtgtgtgatcccttgcgctacttggtcatcatgcatggagggctc
tgtactaagctggccatcacatcctgggtcagtggctctgtcaactctcttgtgcatact
gccatcaccttccagctgcccatgtgctccaacaagtttattgatcacatatcctgtgaa
atcctagctgtggtcagactggcctgtgtggacacctcttccaatgagatcacaatcatg
gtttctagtattgtcctgctgatgtcaccattcttcctggttctgttgtcctacatcagg
atcatttccaccatcctaaagatcaggtccacagagggaagaaagaaagccttccacacc
tgtgcctctcacctcacagtggttgtcctgtgctatggcatggccatcttcacttacatc
cagccccactctggcccctcagcccttcaggagaagttgatctctctcttttatgccatt
ttgacacccatgctgaaccccatgatttatagcctaaggaataaggaggtgaagggggcc
tggcagaaactatcagggcaactatctggattatcgtcaaaactggcaacttga

KEGG   Miniopterus natalensis: 107523825
Entry
107523825         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 6B1
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523825
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523825
SSDB
Motif
Pfam: 7tm_4 7tm_1 FAST_1
Other DBs
NCBI-GeneID: 107523825
NCBI-ProteinID: XP_016050999
LinkDB
Position
Unknown
AA seq 308 aa
MEVENQTRVTKFILVGFPGSWGMRTAVFLMFLLAYILTVAENMVIILLVQQNRPLHKPMY
FFLANLSFLETWYISVTVPKLLFGFWSVSNSISFTHCMIQLYFFIALMCTECVLLAAMAY
DRYVAICRPLHYPTIMTHGLCFHLALASWAIGFGISLAKIYFISCLNFCGPNVINHFFCD
ISPVLNLSCADMSIAELVDFVLALVIFLFPLSVTVLSYGCILATVLRMPTGKRKAFSTCA
SHLMVVTIFYSATIFMYARPRAIHAFNLNKVISIFYAIVTPSLNPFIYCLRNREIKEALK
KLIYCQAI
NT seq 927 nt   +upstreamnt  +downstreamnt
atggaagtggagaaccagacacgcgtcaccaagttcattctggtgggcttccctgggagc
tggggcatgcgcacagccgtgttcctgatgttcctcttggcctatattttgacagtggct
gaaaacatggtcatcatcctgttggtgcagcagaaccggccactgcacaagcctatgtac
ttctttctggccaacctgtccttcctagagacctggtacatctctgtgactgtacccaag
ttgctgtttggtttttggtctgtgagcaacagcatctccttcactcactgtatgatacaa
ctttactttttcattgcgctcatgtgcacagaatgtgtgctcctggctgccatggcctat
gaccggtatgtggccatctgccgcccattgcactaccccaccatcatgacccacgggctc
tgcttccacctggctcttgcttcctgggccattggctttggcatctccttggctaagatc
tacttcatctcttgcctcaacttctgtggccccaatgtcatcaatcacttcttctgtgac
atctctccagtccttaacctgtcctgcgcagacatgtccatagctgagttggtggacttt
gtcctggcgctggtcatcttcctcttccccctctctgtcactgtcctgtcctatggttgc
attctggccaccgttctacgcatgcccacaggaaagcggaaagccttctctacttgtgcc
tctcacctcatggtggtcaccatcttctactcagccactattttcatgtatgcccggccc
cgagccatccatgccttcaacttgaacaaagttatttccatcttctatgccattgtcacc
ccttctctcaaccctttcatttactgcctaaggaaccgagagatcaaggaggctctgaag
aaactaatctattgccaggccatctga

KEGG   Miniopterus natalensis: 107523826
Entry
107523826         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 2A5
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523826
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523826
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107523826
NCBI-ProteinID: XP_016051000
LinkDB
Position
Unknown
AA seq 310 aa
MMENQTWVTEFVLLGFLLSPNMQMLLFGLFSLFYAFTLLGNGVILGLIWLDSRLHTPMYF
FLSHLAIVDISYASNNVPKMLENLLNKKKTISFVPCIIQTFLYMAFAHTECLLLVMMSYD
RYVAICHPLHYSVIMSWRVCTALAATSWVCGSLLALVHVVLILRLPFCGPHEINHFFCEI
LSVLRLACADTRLNQLVIFAASVFILVGPLSLVLVSYTRILFAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSRHPEEQQKILSLFYSLFNPMLNPLIYSLRNAEVKGAL
RRVKGKQRAV
NT seq 933 nt   +upstreamnt  +downstreamnt
atgatggaaaatcagacatgggtcacagaattcgttctcctgggattcctgctcagccca
aacatgcagatgctcctcttcgggctcttctccctgttctacgccttcaccctgctgggc
aacggggtcatcctggggctcatctggctggactcccgactgcacacccccatgtacttc
ttcctctcacacctggctatcgtcgatatttcatatgcttccaacaatgtccccaagatg
ctggagaaccttctgaacaagaaaaaaactatctcctttgtcccatgcataatacagacc
tttttatacatggcttttgctcacactgagtgtcttctcttggtaatgatgtcttatgat
cggtacgtggccatctgccaccccctccattactctgtcatcatgagctggagagtgtgc
acggccctggccgccacttcctgggtatgtggctccctcctggctctggtccacgtggtt
ctcatcctgaggctgcccttctgtgggcctcatgaaatcaaccacttcttctgtgagatc
ctgtctgtcctcaggctggcctgcgccgacactaggctcaaccagctggtcatctttgct
gcttctgtatttatcttagtggggcccctcagcttggtgctggtgtcctacacacgcatc
ctctttgccatcctgaggatccagtctggggagggccgcagaaaggccttctccacctgc
tcctcccacctctgtgtggtcgggctcttctttggcagcgccatcgtcatgtacatggcc
cccaaatcccgccaccctgaggagcagcagaagatcctttccctgttttacagccttttc
aaccccatgctgaacccgttgatctacagcctgaggaatgcagaggtcaagggcgccctg
aggcgagtgaaggggaaacagagagcagtgtga

KEGG   Miniopterus natalensis: 107523827
Entry
107523827         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 13-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107523827
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107523827
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107523827
NCBI-ProteinID: XP_016051001
LinkDB
Position
Unknown
AA seq 310 aa
MGENQTSVTEFLLLGFPLSPGTQMLLFGLFSLFYAFTLLGNGVILGLVWLDSRLHTPMYF
FLSHLAVVDMSYACNTVPQMLVNLLSPAKPISFAGCVTQTFLFLSFAHTECLLLVVMSYD
RYVAICHPLRYAVLVSWRVCINLAVASWTLGVLLALAHTVLLLPLPFCGPQKVNHFFCEI
TALLKLACADTHINEIVVLAGAASVLVGPLSSIVASYVHILCAILKIRSGAGRQKVFSTC
SSHLCVVGLFYGTAIVMYVGPRHGDPTEQKKYLLLFHSLFNPMLNPLIYSLRNRDVKAAL
KRVLDKERSA
NT seq 933 nt   +upstreamnt  +downstreamnt
atgggggaaaaccagacttctgtcaccgagttcctcctgctggggtttcccctgagccca
gggactcagatgctcctcttcgggctcttctccctgttctacgccttcaccctgctgggc
aacggggtcatcctggggctcgtctggctggactcccgcctgcacacccccatgtacttc
ttcctctcacacctggctgtcgtcgacatgtcctacgcctgcaacacggtgccccagatg
ctggtaaacctcctgagcccagccaaacccatctcctttgctggctgcgtgacacagacc
ttcctcttcttgagctttgctcacactgaatgtcttctcctggtggtgatgtcctatgac
cggtatgtggccatctgccaccccctccgatatgctgtcctcgtgagctggagagtctgc
atcaacctggcagtggcttcctggacgttaggggtcctcctggccctggcacatacagtg
ttactcttaccgttgcccttctgtgggccccagaaagtgaatcactttttctgcgagatt
acagctcttctcaagcttgcctgtgcggacacccacattaatgagattgtggttttggct
ggggcagcgtctgtgctggtgggaccgctgtcctccatcgtggcttcctacgttcacatt
ctctgtgccatcctgaagatccggtcaggggccgggcgccagaaagtcttctccacctgc
tcgtcccacctctgcgtggttgggctcttttatggcacagccattgtcatgtatgttggg
ccccgacatggggaccccacggagcagaagaaatatcttctcctgttccacagccttttc
aaccccatgcttaaccccctgatctatagtctgaggaacagagacgtcaaagctgccctg
aagagggtgcttgacaaggagagatctgcatga

KEGG   Miniopterus natalensis: 107524478
Entry
107524478         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 2AT4-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107524478
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107524478
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107524478
NCBI-ProteinID: XP_016051886
LinkDB
Position
Unknown
AA seq 321 aa
MEATACNRSKDSLPVFYLVGIPSLQEALFLPVFVVFLLFYLLILAGNTLILVAVVAEPSL
HKPMYFFLINLSALDILLTTSTVPKILSLLLLRDHFLSFPACFLQMYLFHGFTCSEAFIL
VVMAYDRYVAICRPLHYPVLMTPQTNAALAASAWLTALLLPIPAVVQTSHMAFGSVAQIY
HCFCDHLAVVQASCSDTTGQTFMGFCIAMVVSFLPLLLVLLSYARILASVLRISSQEGRS
KAFSTCSSHLLVVGTYYSSIAIAYVSYRADLPLDFHIMGNVVFAILTPVLNPLIYTLRNK
DVKAAITKMACPWDQGHSGNL
NT seq 966 nt   +upstreamnt  +downstreamnt
atggaggccacagcctgtaatagatcaaaagactctttgcctgtcttctacctggtgggc
atcccctctctacaggaggccctcttcctccctgtgttcgtcgtcttcctgctcttctac
ctgctcatcctggcaggtaacaccctgatcctggtggctgtggtggcagagcccagcctc
cacaagcccatgtacttcttcctgatcaacctctcagccctggacatcctccttaccacg
tcaactgtccccaagatcttgtccctactcttacttagggaccacttcctcagcttccct
gcctgcttcctgcagatgtatctcttccacggcttcacatgctctgaagccttcatcctg
gtggtcatggcctatgaccgctatgtggctatctgccgcccactacactaccctgtcctc
atgaccccgcagaccaatgctgcactggcagccagtgcctggctcactgccctcctcctg
cccatcccagcagtggtgcagacatcccacatggcttttggttctgtggcccagatctac
cactgcttctgtgaccacttggctgtggtccaggcctcctgctctgacaccacgggccag
accttcatgggcttctgcattgccatggtagtgtccttcctgccccttctgctggtgctt
ctctcctatgcccgcatcctggcctcagtgcttcgcatcagctcccaagaaggacgctca
aaagccttctctacctgtagctcccacctcctggtggttggcacctactactcctccatt
gccatagcctatgtgtcctacagggctgacctgcccctggatttccacatcatgggcaat
gtggtgttcgccattctcacacctgtcctcaaccccctcatctacactctgagaaacaag
gatgtcaaagcagccatcaccaaaatggcatgtccctgggaccaagggcactctggaaac
ctttga

KEGG   Miniopterus natalensis: 107524492
Entry
107524492         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 2AT4
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107524492
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107524492
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107524492
NCBI-ProteinID: XP_016051897
LinkDB
Position
Unknown
AA seq 323 aa
MEATTCNGSVDGSPVFYLVGIPSLPESLFLPVFFIFLLFYLLILAGNTLILVAVVAEPSL
HKPMYFFLTNLSALDILFTTTTVPKMLSLFLLGDRFLSFPACLLQMYLFQSFTCSEAFIL
VVMAYDRYVAICHPLRYPVHMTPQTNAALAASAWLTALLLPIPAVVKISQMTYNNIAHIY
HCFCDHLALVQASCSDKTPQTLMGFCIAMVVSFLPLLLVLLSYAHILASVLRISSQEGRS
KAFSTCSSHLLVVGTYYSSIAIAYVSYRADLPLDFHIMGNVVYAILTPILNPLIYTLRNK
DVKAAITKMARLKTQSGIGALGL
NT seq 972 nt   +upstreamnt  +downstreamnt
atggaggccacaacctgtaatggctcagtggatggctcaccggtcttctacctggtgggc
atcccctctctgccagagtccctctttctccctgtgttttttattttcctcttgttctac
ctgctcatcttggcaggtaacaccctgatcctggtggctgtggtggcagagcccagcctc
cacaagcccatgtacttctttctaaccaacctttctgctctggacatcctctttaccaca
accactgtccccaagatgctgtccttattcctgctcggggaccgcttcctcagcttccct
gcctgcttattgcagatgtatctctttcaaagcttcacatgctctgaagccttcatcctg
gtggtcatggcctatgaccgctatgtggctatctgccacccactgcgctaccctgtccac
atgaccccacagaccaatgctgcactggcagccagtgcctggctcactgctctcctcctg
cccatcccagcagtagtgaaaatctcccagatgacttataacaacattgctcacatctac
cattgcttctgtgatcatctggctcttgttcaggcctcctgctctgacaagactccccag
accctcatgggcttctgcattgccatggtagtgtccttcctgccccttctgctggtgctt
ctctcctatgcccacatcctggcctcagtgcttcgcatcagctcccaagaaggacgctca
aaagccttctctacctgtagctcccacctcctggtggttggcacctactactcctccatt
gccatagcctatgtgtcctacagggctgacctgcccctggacttccatatcatgggcaat
gtggtgtatgctatcctcacacctatcctcaaccccctcatctacactctgagaaacaag
gatgtcaaagcagccatcaccaaaatggcacgtctcaagacccagtctgggataggagcc
cttggcctttag

KEGG   Miniopterus natalensis: 107525685
Entry
107525685         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 7D2
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525685
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525685
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx Bac_export_2
Other DBs
NCBI-GeneID: 107525685
NCBI-ProteinID: XP_016053409
LinkDB
Position
Unknown
AA seq 313 aa
MKAGNKTGIFEFTLLGLSEDPELQPLLLGLFLSMYLVTVLGNLLIIVIIGSDPRLHTPMY
FFLSNLSVVDICFSTTIVPKMLVSIQTENKAISYMSCLTQVYFSMFFPILDTLLLTVMAF
DRYVAICQPLHYTVIMNPRLCGLLVFMTWFIGVMTSLLHISLMVHLNFCRDLEIPHFFCE
LTQVLRLACSDTFLNSILVYFMTGVLGVVPLLGILFSYSRITSSIKKMSSSQGKQKAFST
CGSHLSVVSLFYATGIGVYFTSAATHSSQKVSVASVMYTVVTPMLNPFIYTLRNKDVKGA
LGRLLHRAASCLC
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaagcaggaaacaaaacaggaattttcgagtttaccctccttggactctctgaggac
ccagaactgcagcccctcctactggggctgttcctgtccatgtacctggtcaccgtgctg
ggaaacctgctcatcatcgtcatcatcggctccgacccccgcctccacacgcccatgtac
ttcttcctgtccaacctgtccgtggtggacatctgcttcagcaccaccatagtccccaag
atgctggtgagcatccagacagagaacaaggccatttcctacatgagctgcctcactcag
gtatatttttccatgttttttcctatcctggacactctgctcctgaccgtgatggccttt
gaccggtatgtggccatctgtcagcccctgcactacacggtcatcatgaaccctcgcctc
tgcggcttgctagtttttatgacttggttcattggtgtcatgacatccctcctccatatc
tctctgatggtgcatctgaatttctgcagagatctcgaaattccgcatttcttctgtgag
ctgacacaggtcctcaggttggcctgctctgacaccttcctgaatagcatattggtatat
tttatgacgggtgtgctgggtgtggtcccccttttggggatcctattctcctactcaaga
attacctcttccataaagaagatgtcctcatcgcagggaaagcaaaaagcattttccacc
tgtgggagtcacctctcagtagtttctttattttatgcaacaggcattggggtttacttc
acttctgcagcgactcactcttcccagaaagtctcggtggcctcagtgatgtacactgtg
gtcacccccatgctgaaccccttcatctacaccctgaggaacaaggatgtgaagggggcc
ctgggaaggcttctccacagagcagcctcttgtctgtgctag

KEGG   Miniopterus natalensis: 107525686
Entry
107525686         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 7D4-like isoform X1
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525686
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525686
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107525686
NCBI-ProteinID: XP_016053411
LinkDB
Position
Unknown
AA seq 312 aa
MEAGNQTATSKFILLGLSQDMDLQPHLFGLFLSMYLVCVTGNLLIIAAISSDSRLHTPMY
FFLSNLSFVDICFTSTTVPKMLVNIQTQSKDIMYEGCMTQMYFFMIFAGLDDLLLTVMAY
DRFVAICHPLHYTVIMSPRLCSLLLLLSWLICLTYSLLQSLMVLRVSFCKETEIPHFFCE
LAQILKLACSDTLANNILQHFITSLLGVIPLTGILFSYSRIISSIMGISSAGGKYKVFST
CGSHLSVVSLFYGAGLGVYLTSGTAHPSRKGSIASVMYTVVTPMLNPFIYSLRNRDMKKA
LRKLFSREAYSW
NT seq 939 nt   +upstreamnt  +downstreamnt
atggaagcagggaaccaaacagctacttcaaaattcatccttctgggactttcccaagac
atggacctgcagccccacctctttgggctgttcctgtccatgtacctagtctgtgttaca
ggaaacctgctcatcattgcggccatcagctccgactcccgcctccacacccccatgtac
ttcttcctgtccaacttgtcctttgttgacatctgtttcacctccaccaccgtcccgaag
atgctggtgaacattcagacacagagcaaagacatcatgtatgaaggttgtatgacccag
atgtatttcttcatgatttttgctgggctagatgatttgctcctgacagtgatggcctat
gaccggtttgtggcaatctgccaccccttacactacacagtcatcatgagccctcgcctt
tgtagtctcctgctgctgctttcttggttaatctgcctgacctattctttgctgcaaagt
ctgatggtattgagggtgtccttttgcaaagaaacagaaatcccccacttcttctgtgaa
cttgctcagatcctcaagcttgcctgctctgacacccttgccaacaacatcctacagcat
tttataactagcctgctgggtgtcattcccctgactgggattcttttttcttattctaga
attatctcctccataatgggcatttcatctgctgggggtaagtataaagtcttttctacc
tgtgggtctcacctctcagttgtctccttgttctacggtgctggccttggggtctacctc
acttctggaacagctcacccctccagaaagggttcaatagcctcggtgatgtacacagtg
gttacccccatgctgaaccctttcatctatagtctgaggaacagggacatgaaaaaggct
ctgaggaaacttttcagtagagaagcttactcttggtga

KEGG   Miniopterus natalensis: 107525687
Entry
107525687         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 7D4-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525687
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525687
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107525687
NCBI-ProteinID: XP_016053414
LinkDB
Position
Unknown
AA seq 312 aa
MDAENHTAVSEFLLLGLLDDPKLQPLFCGVFLSMYLVTVLGNLLIMLAISSDSRLHTPMY
FFLSNLSFVDICFTSTTVPKMLVNIQAQSKAISYIGCLTQVYFFTVFAGMDNFLLTLMAY
DRYVAICHPLHYTVIMNPRLCGSLVLMSWFIIFWVSLVHILLMRWLTFSIDTEIPHFFCE
LAQILKVACSDTLINNIFLYVTTSLLGVFPLTGILFSYCKIVSSLMRMSSAVGKYKAFST
CGSHLSVVSLFYGTGLGVYLSSALTHSTLQNSVASVVYTVVTPMLNPFIYSLRNKDVKGA
LGRLLNRAASCP
NT seq 939 nt   +upstreamnt  +downstreamnt
atggacgcagaaaaccacacagcagtgtccgaattcctcctcctgggtctcttggatgat
cctaaactgcagcccctcttctgtggagtgtttctgtccatgtacctggtcactgtgctg
ggaaacctgctcatcatgctggccatcagctctgactcccgcctccacacccccatgtac
ttcttcttgtccaacctgtcctttgttgacatctgcttcacctccaccaccgtcccaaag
atgctggtgaacatccaggcacagagcaaagccatctcctacattgggtgcctcactcag
gtgtatttttttacagtttttgctggaatggacaactttctcctgaccctgatggcctat
gaccggtatgtggccatctgccaccccctgcactacacagtcatcatgaacccccggctc
tgtggctccctggttctgatgtcttggttcataattttctgggtctccctggttcatatt
ctactaatgaggtggctaaccttcagtatagacactgaaattccacattttttctgtgaa
ctggctcagattctcaaggtggcctgctctgacacactcatcaataacatcttcttgtat
gtgactacttctctactgggtgtgtttcctctcactgggattctcttttcttactgtaag
attgtctcctctttaatgagaatgtcctctgcagtgggaaaatataaagcattttccacc
tgtgggtctcacctctccgtggtctccttgttctatgggacaggcctgggggtctacctc
agctctgctctgacccattctaccctacaaaactcagttgcctcagttgtgtacactgtg
gtcacccccatgctgaaccccttcatctacagcctgaggaacaaggatgtgaagggggcg
ttgggaaggctcctcaaccgagcagcttcttgtccatga

KEGG   Miniopterus natalensis: 107525724
Entry
107525724         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 7G1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525724
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525724
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107525724
NCBI-ProteinID: XP_016053445
LinkDB
Position
Unknown
AA seq 333 aa
MLPRNQTDVSEFLLLGLTDDPELQSLLFHLFLSIYLVTVLGNLLITLAVISDSHLHTPMY
FFLSNLSFTDICMSTVTIPKMLVNIQTQNQSIPFIGCLAQIGLVLVWGIFENFLLAAMAY
DRYVAICHPLRYTVIMNVHLCVLLTVLSLFLSTMAALLHSLMVLRLSFCKDLEIPHFFCE
LAQVLKLACSDTLINNLLIYFVISLFVGIPLCGIIFSYSQIVSCVLRIPSAGGKLKVFST
CGSHLSVVSLFYGTGLGVYISFAISDSSRKTAVASMMYAVFPQMMNPFIYSLRNRDMKRA
LMKLTGRIRSFLILCHLLMARVSRMRESARNPG
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgttacctagaaaccaaacagatgtttcagaattcctgctgctgggattgacagatgac
ccagagctgcagtccctcctcttccacctgttcctgtccatctacctggtcacagttctg
ggaaacctgctcatcacactggccgtcatctctgactctcacctgcacacccccatgtac
ttcttcctctccaacctgtcctttactgacatctgtatgagcacagtcaccatcccaaag
atgctggtgaacatccaaacacagaatcagagcatcccttttataggctgcctcgcccag
attggcttggtcttggtctggggcatatttgagaattttctcctggcagcaatggcctat
gaccgctatgtggccatttgtcaccccttgaggtacacagttatcatgaatgtccatctc
tgtgttctgctcactgtactctcactgttccttagtacaatggctgccctgctccacagc
ctgatggtgttgcggctgtccttctgcaaggatctggaaatccctcacttcttctgtgag
cttgctcaggtcctcaagcttgcatgttctgataccctcatcaataaccttctcatatat
tttgttataagcctatttgttggtattcccctgtgtggaatcattttctcttatagtcaa
attgtctcctgtgttttgagaataccatctgcaggggggaagcttaaagttttttctact
tgtgggtctcacctctcagtagtctccttgttctatggaactggtttgggtgtgtacatt
agttttgcgatctctgactcatccaggaagactgcagtggcttcaatgatgtacgctgtg
tttcctcaaatgatgaacccctttatctacagcctgaggaacagggacatgaaacgagct
ttgatgaaactcactggcaggatacgttcttttctgattttgtgccatttacttatggct
agggtttctagaatgagggaaagtgctagaaatcctggttga

KEGG   Miniopterus natalensis: 107525725
Entry
107525725         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 7G2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525725
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525725
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107525725
NCBI-ProteinID: XP_016053446
LinkDB
Position
Unknown
AA seq 312 aa
MEPRNKTDISEFFLLGLTNDPELQSLLFYLFLSIYLATILGNLLIILAVISDPHLHTPMY
FFLSNLSFNDICLSTTTIPKMLVNIQAQNQSISYLGCLTQICFVMVFVGLENFILAAMAY
DRYVAICHPLRYTVIMNTHLCILVIVLSLLISIGNALLHSLMVLRLSFGKDLEIPHFFCE
LAQVIKLACSDTLINNIFIYSMASLLGGIPLCGIIFSYTQIVSSVLRIPSAGGKYKGFLT
CGSHLSVVLLFYVTVVGVYITSEITGSSRKTSVASVMYIVIPQMLNPFIYSLRNKDMKGA
LKSLIGRISSFL
NT seq 939 nt   +upstreamnt  +downstreamnt
atggagcccagaaataaaaccgatatttcagaattctttctcttgggattgaccaatgac
ccagagctgcagtccctcctcttctacttgttcctgtccatctacctggccaccattctg
ggaaacctgctcatcatcctggctgtcatctctgacccccacctgcacacccctatgtac
ttctttctctccaatctgtcttttaatgatatctgtttaagcacaaccacaatcccaaag
atgctggtgaacatccaagcacagaatcagagcatcagttatctaggctgcctcacccag
atctgcttcgtcatggtgtttgttggtttggaaaatttcatccttgcagcaatggcctat
gaccgctatgtggccatttgtcacccactgagatacacagttatcatgaatacccatctc
tgtattctggtgattgtgctctcgctgctcattagcattgggaatgccctgctccacagc
ctgatggtgttgcggctgtcctttggtaaggatttggaaatccctcactttttttgtgag
cttgctcaggtcatcaagcttgcatgttctgataccctcatcaataacatcttcatatat
tctatggctagcctccttggtggtattcctttgtgtggaatcattttctcttatactcaa
attgtctcctctgttttaagaataccatctgcgggggggaagtataaaggttttctgacc
tgtgggtctcacctctcagtggttttgttgttctatgtgacagttgttggggtgtatatt
acttccgaaattaccggctcttctagaaagacttcagtggcatcagtgatgtacattgtg
attcctcaaatgttgaacccttttatctacagcctgaggaacaaggacatgaagggagcc
ttgaagagtctcattggtaggatatcttcttttttatga

KEGG   Miniopterus natalensis: 107525727
Entry
107525727         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 7G3-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525727
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525727
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107525727
NCBI-ProteinID: XP_016053447
LinkDB
Position
Unknown
AA seq 312 aa
MESENQTGVAEFLLLGLSEDPEQQPLLCGVFLSLYLVTVLGNLLIIVAVGSDSRLHAPMY
FFLSNLSLVDICFTSTIVPKMLVNIQTKNKAITYAGCLTQIYFFMFFMCMDNLLLTAMAY
DCYVAICQPLTYAAVMSPGLCGLLVLVSLVISLMNALLHSLMVLHLSFCSDLKIPHFFCD
LAQILKLACSDTLINNILMYLVTILLGIGPLSGIIFSYTRIVSSILRIPSAGGKYKAFST
CGSHLSVVLLFYGTCVGVYLSSAASLSPRRRAVASVMYTVVTPMMNPFIYSLRNRDIQGA
LRKFIPRTGSFS
NT seq 939 nt   +upstreamnt  +downstreamnt
atggaatcagaaaaccaaacaggcgtagcagaattcctgctcctgggtctctcagaggac
ccagaacagcagcccctcctctgtggagtgttcctgtccctgtacctggtcaccgtgctt
ggcaacctcctcatcattgtggccgtcggctctgactcccgcctccacgcccccatgtac
ttcttcctgtccaacctgtccttggtggacatctgcttcacctccactatagtccccaag
atgctggtcaacatccagacaaaaaacaaagccatcacctacgcaggctgcctcactcag
atatattttttcatgttttttatgtgtatggacaatttactcctgaccgcgatggcttac
gactgctatgtggccatctgccagcctctgacctacgcggccgtcatgagcccaggcctc
tgcggcctgctggtccttgtctccctggtcattagccttatgaacgccctgctccacagc
ctgatggtgctgcatctgtccttctgctcagacttgaaaatcccgcactttttctgtgat
ctcgctcagatcctcaaacttgcctgttctgataccctcatcaacaacatcctgatgtat
ttagtgactatccttttgggtattggtcccctttctgggataattttctcttacactcga
attgtctcctccatcctgagaatcccatcagctggtggaaagtataaagctttttccacc
tgtgggtctcacctgtctgttgttctcttgttctatgggacttgtgttggagtctacctt
agttctgcagcctctctctcccccaggaggagggcagtggcctcggtgatgtacacagtg
gtcactcccatgatgaaccccttcatctatagcctgaggaatagagacatacagggagct
ttaaggaaattcatccctagaacaggttccttttcatga

KEGG   Miniopterus natalensis: 107525754
Entry
107525754         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 24
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525754
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525754
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107525754
NCBI-ProteinID: XP_016053479
LinkDB
Position
Unknown
AA seq 312 aa
MEPRNQTSISEFILLGLSEKTEMETLLFALFLCMYVVTVVGNLLIILAISSDSRLHTPMY
FFLANLSLVDFGLATNTVPKMLVNIQTKSRLISYPCCLTQMYFFHFFGIVDSVLIAVMAY
DRFVAICHPLHYTTIMNPSRCGLLAGGPWVFSYFISLTHILLMVRLVFCGNKIPHYFCDL
NPLLRISCTDTSVNKIFVLVVAAMVIATPFICILASYARIIAAILQVPSAGGRKKAFSTC
SSHLSVVALFYGTTIGVYLCPSSVHTAVKEKASAVMYTTVTPMLNPFIYSLRNRDINGAL
RKLINRKITSSS
NT seq 939 nt   +upstreamnt  +downstreamnt
atggaaccaaggaaccaaaccagtatatctgaattcattcttctagggctttcagaaaaa
acggaaatggagaccctcctctttgctctgttcctctgcatgtacgtggtcacggtagtg
gggaacctgttgatcatcctggccatcagctcagactcccgccttcacacgcccatgtac
ttcttcttagccaacctgtccttggttgactttggcctggccaccaacactgtccccaag
atgctggtgaatattcaaactaagagcaggcttatctcctatccttgctgcctgacccaa
atgtactttttccatttttttggcattgtggacagtgtcttaattgcagtgatggcttat
gacagatttgtggctatttgtcacccattacactataccaccatcatgaacccaagccgt
tgtggcctgctggctggtggcccgtgggtgttttcctactttatctccctcacacacatc
ctcctgatggtgcgcctggttttctgtgggaacaagattcctcactacttctgtgacctc
aatccccttctcagaatttcttgcactgacacttctgtgaacaagatctttgtgctcgtt
gtggccgcgatggtgatagccacacctttcatctgcatcctggcttcctatgctcgcatc
attgcggccatcctgcaggtcccctctgccggtggtaggaagaaagccttttccacctgc
agctcccacctctctgtggttgccctcttttatgggaccaccattggggtctatctgtgt
ccttcatcagtccacacagctgtgaaggagaaagcctctgctgtaatgtacactacagtc
acccccatgctgaacccctttatctacagcctgagaaacagagacataaatggggccctg
aggaagctcatcaatagaaaaatcacctcatcttcctaa

KEGG   Miniopterus natalensis: 107525755
Entry
107525755         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 7G3-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525755
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525755
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107525755
NCBI-ProteinID: XP_016053480
LinkDB
Position
Unknown
AA seq 312 aa
MKSGNLSDAAEFLLLGLSDDPELQPLLFCLFLSLYLVTVLGNLLIIVAIISDSRLHTPMY
FFLSNLSLVDICFTSTTVPKMLLNIQTQSRAISYTGCLTQVCFVLTFAGLENGILIMMAY
DRFVAICHPLRYNIIMNPRLCGLLVLLAFLISVLDALLHTLMALRLSFCTDLRILHFFCE
LAHILKLACSNIFINNVLVYLVTSLLGVVPLSGIIFSYTRIVSSILKIPTAGGKYKAFST
CGSHLIVVSLFYGTGFGVYLSSAATHSSRKSAIVSVIYTVVTPMMNPFIYSLRNKDMIGA
LSKLISRISSFH
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaaatcaggaaacctctctgatgctgcagaattcctcctcctgggactgtcggatgat
ccagagctgcagcccctcctgttctgcctgttcctgtccctgtacctggtcactgtgctt
ggcaacctgctcatcattgtggccattatctctgactcccgcctccacacgcccatgtac
ttcttcctgtccaacctgtccttggtggacatctgcttcacctccaccaccgtcccgaag
atgctgctcaacatccagacgcagagcagagccatcagttacacaggctgcctcacccaa
gtctgctttgtcctgacttttgctggattggaaaatggaattctgataatgatggcctat
gatcgatttgtggccatctgccacccactgagatacaacatcatcatgaaccccagactc
tgtgggctgctggtcctgctggccttccttattagtgtcctggatgccctgctccacact
ctgatggcactgcggctgtccttctgcacggacctgagaatcctgcactttttctgtgaa
ttagctcatattctgaagctcgcctgttctaatatcttcatcaataacgtccttgtgtac
ttagtgaccagcctcttgggtgttgttcctctctctgggataattttctcttatactcga
attgtctcctccatcctgaaaatcccaacagctggtggaaagtataaggcattttccact
tgtgggtcacacttaatagttgtttccttgttctatgggacaggttttggggtatacctt
agttctgcagctacacactcttccaggaagagtgcaatagtgtcagtgatatatacagtg
gtcacacctatgatgaacccatttatctacagtctgaggaacaaggacatgataggggct
ttgagtaagctcatctctagaatatcatcttttcattga

KEGG   Miniopterus natalensis: 107525757
Entry
107525757         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 7A5-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525757
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525757
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107525757
NCBI-ProteinID: XP_016053481
LinkDB
Position
Unknown
AA seq 306 aa
MEPGNQTSVSEFLLLGFSQDSEHLPILFGLFLSIYLVTVLGNLLIIVAISSDSRLHTPMY
FFLSNLSFVDICFTSTTVPKALVNIQTQSKAITYAGCIAQVYFFLVFGGMDTFLLTVMAY
DRFVAICHPLHYPVIMNPCLCGLLVLVSWSISLTYSLIQSLLMLRLSFCTNWVISHFYCE
LTQALAIACSDTLISHILLYMVIGLLGIVPFSGILFSYIRIVSSILRIPSAVGKYKAFST
CGSHLSVVSLFYGTGLGVYLSSDAPSWRGMIASVMYTVITPMLNPFIYSLRNRDIKRALQ
KLFSLV
NT seq 921 nt   +upstreamnt  +downstreamnt
atggaaccaggaaatcaaacaagtgtttcagagtttttacttctgggattttcccaagac
tcagagcatctgcccatcctatttgggctgttcctctccatatacctggtcaccgtactt
gggaacctgctcatcattgtggccatcagctctgactcccgcctccacacccccatgtac
ttcttcctgtccaacctgtcctttgttgacatctgcttcacctccaccaccgtcccgaaa
gcgctggtgaacatccagacacagagcaaagccatcacctatgcaggctgcatcgcccag
gtgtactttttcctggtttttggaggtatggacacttttctcctcaccgtgatggcctat
gaccggtttgtggccatctgtcaccccttgcactacccagtcatcatgaacccctgcctc
tgtggcctcctggttctcgtgtcctggtccatcagcttaacatactccctgatccagagt
ctgttgatgttgaggctgtctttctgcactaactgggtgatttcacacttttactgtgaa
ctcactcaggccctcgctattgcctgctcggacacactcatcagtcacatcctgctatat
atggtgattggccttcttggcattgtccccttctcaggaattcttttctcctatattcga
attgtctcctcaatcctgagaatcccatcagcagttgggaaatataaagcattttctacc
tgtgggtcccacctgtccgtggtttctttattctatgggacaggccttggtgtgtatctc
agttctgatgcaccttcctggaggggcatgattgcctccgtgatgtatactgtgatcacc
ccaatgctgaaccccttcatctatagcctgcggaacagggacatcaagagggccctacaa
aaattgttcagtctggtctaa

KEGG   Miniopterus natalensis: 107525774
Entry
107525774         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 13H1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107525774
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107525774
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx Cyclin_N
Other DBs
NCBI-GeneID: 107525774
NCBI-ProteinID: XP_016053502
LinkDB
Position
Unknown
AA seq 308 aa
MAMNNATTVFEFFLIGISNYPEWRVTFFTLVLITYLTILLGNGFIIILIHIDPRLHTPMY
FFLSNLSFLDLCYGTVSMPQTLLHCFSTHPYLSYPRCLTQMSVSLFLATAECLLLAVMAY
DRVVAISNPLRYFMVMNGPVCVWLAATSWGASLVLTAMLILSLHLHFCGVNVINHFVCEI
VSLLKLACSDTSLNEHMILITGIFTLLLPFGFVLLSYVQIATAVLKIRSAQGRHKALSTC
GSHLTVVSIFYGTAISTYMKHQSKSSPNLDKFISVFYGAVTPMLNPLIYSLRNKDVKEAM
RKVMAKRE
NT seq 927 nt   +upstreamnt  +downstreamnt
atggccatgaacaatgctacaacagtgtttgagtttttccttattggaatctctaactat
cctgagtggcgagtcacatttttcacattggtgctaataacttacctcaccatattgttg
gggaatggatttatcatcattcttatccacattgacccacgcctccacactccaatgtac
ttctttcttagtaacttgtctttcttagacctttgctatggaacagtctccatgccccag
accttgttgcattgtttttctacacatccctacctttcttatccaagatgtttgacccaa
atgagtgtctccttgttcttggccacagcagagtgcctcttactggctgtgatggcctat
gaccgtgtggttgctatcagcaatcccctacgctactttatggtcatgaatggtccagtg
tgtgtctggctggctgccacctcatggggggcatcacttgtgctcactgccatgctcatc
ttatccctgcatctgcacttctgtggggttaatgtcatcaaccactttgtctgtgagatt
gtctccctgctcaagctggcttgttctgataccagcctcaacgagcatatgatcctcatc
acaggtatcttcaccttgctcctaccctttgggtttgttcttctctcctatgtccaaatt
gccactgctgtcttaaagattcgctcagcccagggtagacacaaggctttgtctacctgt
ggttctcatttgactgtagtgtcaatcttctatggcacagccatctccacatacatgaaa
catcaatccaagtcatcccctaacctagacaagtttatctcagtgttttatggggctgtg
acacccatgctgaaccctctaatatacagcctgaggaacaaagacgttaaagaggcaatg
agaaaagttatggcaaaaagagaataa

KEGG   Miniopterus natalensis: 107526850
Entry
107526850         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory receptor 51F2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526850
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107526850
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107526850
NCBI-ProteinID: XP_016054940
LinkDB
Position
Unknown
AA seq 289 aa
MVTVMILCLPFAGCVNLDKLLQLCEPQFSHVYLPRLCRKEKRTRVHMAYTESSEKHQATF
IKKKNILHFNACLRQMFLIHLFTRTESLVLLAVASDRFVAISNPLRGTTIRTHARITQVG
SAVITRGTVTLTPLVLLLRGLSFCCGHVLYHSHCFHPEVTKLSCSDTKVNSALGLTAMIS
AAGVDSVFILLSCVLIVCSVLNIASPVERKKAFSACVSHITAVAISYIPLISLSFLHRLG
KCAPPCVSTLIANLYLLVPPVMKLIIYSVKTGQIQKAMLKLLCCKRTHI
NT seq 870 nt   +upstreamnt  +downstreamnt
atggtgacggttatgatcctgtgtttaccatttgccggctgtgtgaacttggacaagctc
cttcaactctgtgaacctcagttttctcatgtctacctcccaaggctttgtaggaaggaa
aagagaacccgggttcacatggcatatactgagagctctgaaaaacatcaggcaactttc
attaaaaaaaaaaatattttgcacttcaatgcttgcttgcggcagatgttcctcattcac
ctcttcactcgcacggaatccttggtgctcctggctgtggcctctgatcgttttgtggcc
atttctaaccccttgagaggcaccaccattcgaactcatgcaagaatcacacaggttggc
tcggcagtcattaccagggggactgtcaccctgacaccactagtcctgcttcttaggggt
ctgtcattctgctgcggccacgtgctctatcactcccactgcttccaccctgaagtgacg
aagctctcttgttcagatacaaaggtcaatagtgcacttggactaactgcaatgatctct
gccgctggagtggactccgtctttatcctgctttcctgtgtcttgatcgtttgctctgtt
ctcaatattgcatccccagtggagaggaaaaaggccttcagtgcctgcgtttctcatatc
actgctgtggccatttcctacatccctttgatcagcctgtcttttcttcacagattagga
aaatgtgctccaccctgtgtgtccacactcattgctaatttatacttgctcgtcccccct
gtgatgaagctcatcatctatagtgtgaaaacagggcagattcaaaaagcaatgctcaaa
cttctatgttgcaagagaactcatatctaa

KEGG   Miniopterus natalensis: 107526991
Entry
107526991         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4F17-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526991
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107526991
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107526991
NCBI-ProteinID: XP_016055104
LinkDB
Position
Unknown
AA seq 312 aa
MDQVNGSVVTKFVLLGLTQTLGMQSFLFLLFSLVYAGIILGNLFIVFTVIFDSHLHSPMY
ILLANLSLIDLGLSSTTVPRMISDLFSDCKIISFHSCMIQMFFIHVMGGVEMALLIAMAY
DRYTAICKPLHYLTIMSPQMCMLLIVAAWIIGVIHAVSQFVFVINLPFCGPNNVGSFYCD
FPRVIKLACMDTYRLEFVVTANSGFISTGTFFFLIMSYIFILVTVRNHSSKDLSKAFFTL
SAHITVVVLFFTPCMFLYVWPFPTKSLDTFFSIVDFVVTPVLNPVIYTLRNRDMKVAMKR
LTGKVVSSPEMM
NT seq 939 nt   +upstreamnt  +downstreamnt
atggaccaagtaaatggctctgtggtaactaagtttgtgttactgggacttacacaaacc
ttgggaatgcagtcttttctttttcttttattctctttagtctatgcgggaattatcctg
ggaaacctcttcattgtgttcacagtaatttttgattctcacttacattcccccatgtat
attctgctggccaacctatcgctcattgacctgggcctttcatctaccacagttcccagg
atgatatctgatcttttcagtgattgtaaaatcatttccttccacagttgcatgatacaa
atgttctttattcatgttatgggaggagtggagatggcactgctcatagccatggcatat
gaccgttacactgcaatctgcaaacctctccactatctaactattatgagtccccaaatg
tgcatgcttttgatagtggctgcttggatcattggagtgattcatgcagtgtctcagttt
gtttttgtcataaatttacctttctgtggccctaataatgtggggagcttttattgtgat
tttcctagggtaattaaacttgcgtgcatggacacttacagattagaatttgtggtcact
gccaacagtggcttcatatctacgggaactttctttttcttaattatgtcatatatcttt
attctggtcactgtcagaaatcattcttcaaaggatttgtccaaagcattcttcactctg
tcagctcacatcactgtagtggttttatttttcactccatgcatgtttctctatgtgtgg
cctttcccaaccaagtccttggatacatttttttccattgtggactttgttgtcacccct
gtcttaaatcctgtcatctatactctaaggaacagagatatgaaagtggcaatgaaaaga
ttgactggaaaagttgtaagttctccggagatgatgtga

KEGG   Miniopterus natalensis: 107526992
Entry
107526992         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory receptor 4F15-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526992
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107526992
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107526992
NCBI-ProteinID: XP_016055105
LinkDB
Position
Unknown
AA seq 307 aa
MAFRKLKCWPMKTFENRDKKLLLILICSLLYLGVILGNLFILFLVIFDSHLHSPMYFLLA
NLSLIDMGLSSTAIPKIITDLLNEYKVISFQSCMTQICFIHIIGGVAMVLLRAMAFDRCT
AIFKPLQYLKIMNSKVCVSFVITGWVTGVIHAXVSVFFVINLPFCGPNKVDSFYCDFPKI
IKLACTGGAKLEFIVTANSGFMTMATFVLLILSYSFILVTIWKCSSGDLSKAFFTLSSHI
TVVFLFFTPCIFLYIWPSPPPSLDKNLFIVDFAITPVLNPAIYTLRNKDIKVAIKRLHKK
ISYFRFC
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcgtttcgtaaactgaaatgctggccaatgaagactttcgaaaaccgagacaaaaaa
cttcttctcatcttgatatgttctttgctctatttaggggtcatcttggggaaccttttt
attttgtttttggtaatttttgattctcatttacattctcctatgtacttcctgctggcc
aacctgtccctcattgacatgggcctttcctctactgcaattcctaagataatcacagat
cttttaaatgaatacaaagtaatctcttttcaaagttgcatgacacagatatgtttcatt
cacatcataggaggagtggcgatggttttactcagagccatggcatttgataggtgcaca
gcaatctttaagccacttcaatacttgaaaatcatgaattctaaagtgtgtgtttcattc
gtaatcactggctgggtaactggggtgatccatgctnatgtctcagttttttttgttata
aacttgcctttctgtgggcctaacaaagttgacagcttttactgtgactttcctaagatt
ataaaacttgcatgcacaggtggagccaagcttgagtttattgttactgccaacagtggc
ttcatgactatggccacttttgtcctgctaatcctttcctattccttcattttggtcacc
atctggaaatgttcttcaggagacttatctaaggcatttttcactttgtcatctcatatc
actgtggtttttttgtttttcactccatgcatatttctttatatctggccttctccccca
ccatcactcgataaaaacctgttcattgttgactttgctattacacctgtcttgaatcct
gccatctatacattaaggaacaaagacataaaggtagcaataaaaagattgcacaaaaag
atatcttatttcagattttgttga

KEGG   Miniopterus natalensis: 107526993
Entry
107526993         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4L1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526993
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107526993
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107526993
NCBI-ProteinID: XP_016055106
LinkDB
Position
Unknown
AA seq 312 aa
MDFKNGSAVTEFVLLGFPGQWELQIFFFLTFSLVYSATVLGNILIIVTVTFSSTLHSPMY
FLLGNLSFLDMCLSTVTTPKMITDLLAEHKTISIWGCMTQMFFLHFFGGAEMTLLIAMAF
DRYVAICKPLHYRAIMSHRLLNGFVILSWIIGFIHTMSQMVLTVNLPFCGPNVVDNIFCD
LPLVINLACIKTYTLELFVIADSGLLSLICFTLLLVSYTVILVTVWQRSPGGLSKALSTL
SAHVIVVTLFFGPCVFIYAWPFNSFAGNKILSVFYTVITPFLNPIIYTLRNQKMQGAMIK
LWFLLANSTQNF
NT seq 939 nt   +upstreamnt  +downstreamnt
atggatttcaaaaatggatctgcagtgactgagtttgttttactaggatttcctggacaa
tgggaacttcagattttcttctttctcacattctccttggtctacagtgctactgtgttg
ggaaacattctcattatagtcacagtaacatttagctccacccttcattctcccatgtac
ttcttacttggaaacctctcctttttggacatgtgtctctccactgtcaccacacccaag
atgatcacagacttgctcgctgaacacaagaccatctccatatggggctgcatgacccaa
atgttctttttgcacttctttgggggtgctgagatgactcttttgatagccatggccttt
gatagatacgtagccatatgtaaacccctgcactacagggcaatcatgagccaccggttg
ctgaatgggtttgtgatactttcatggataattggatttatacacaccatgagccagatg
gtattaacagtgaacctgcctttctgtggccccaatgttgtagacaatatattttgtgac
cttccccttgtgattaaccttgcttgtatcaaaacatataccctggaattatttgtcatt
gctgacagtggcctgctctcactcatctgtttcaccctcctgcttgtctcctacactgtc
atcctggtcactgtatggcaaagatcacctggagggctctccaaggctctgtccacattg
tctgcacatgtcattgttgtcactctgttctttggaccttgtgtctttatctatgcctgg
ccattcaatagctttgcaggcaataaaatcctttctgtattttacactgttatcacaccc
ttcctaaatcctattatttatactctgagaaatcagaaaatgcaaggggcaatgataaaa
ttatggttcctacttgctaactctacacagaacttctaa

KEGG   Miniopterus natalensis: 107526994
Entry
107526994         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4Q2
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526994
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107526994
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107526994
NCBI-ProteinID: XP_016055107
LinkDB
Position
Unknown
AA seq 312 aa
MEENQTEVVREFALAGFSQTPSIEAGLFVLFFFFYVSTWLGNVLIMVTVASDNNLNSSPM
YFLLGNLSFLDLCYSTITTPKLLADFLDNKKLISFDQCIVQLFFLHFVGAAEMFLLTVMA
YDRYVAICRPLHYTTIMSRGLCCVLVAASWMGGFVHSTVQTILTIRLPFCGPNQVDNFFC
DVPPVIKLACADTFVIELLMVSNSGLISTSSFVVLISSYTTILVKIRSKEGRRKALSTCG
SHLMVVTLFFGPCIFIYARPFSTFSVDKMVSVLYNVITPMLNPLIYTLRNKEVKSAMRKL
WGRSGLPCKKQA
NT seq 939 nt   +upstreamnt  +downstreamnt
atggaggaaaatcaaacagaagtggtgagagaatttgccctggccggcttctcgcagaca
ccatctattgaggcagggctgtttgtactattttttttcttctatgtgtccacatggcta
ggcaatgtcctcatcatggtcacagtggcctctgataacaatctaaattcatcacccatg
tattttcttcttggcaacctctctttcctggacctttgttactcaacaataactacccct
aagcttctggctgactttcttgataataaaaagctcatttcctttgaccaatgcattgtg
caactcttcttcctgcattttgtaggcgcagctgagatgttcctgctcacggtgatggcc
tatgatcgctatgttgcaatttgtcgtcccctgcactataccactatcatgagtcgagga
ctatgctgtgtgttggtagctgcctcctggatgggaggatttgttcactctactgtccag
acaattctcactattcgtttgcccttttgtgggccaaaccaggtggacaacttcttttgt
gatgttccccctgtcatcaaactcgcctgtgcagacacatttgtcattgaattactaatg
gtgtctaacagtgggttgatctctaccagctcgtttgtggtgcttatttcttcctacacc
actatccttgtcaagattcgctccaaggaggggaggcgaaaggcactctccacctgtggc
tcccacctcatggtagtgacactcttttttggaccctgtattttcatttatgctcgtccc
ttctccactttttctgtggacaaaatggtatctgtactctacaatgttatcacccccatg
ctgaatcccctcatttacacacttcgaaacaaagaggtcaagtccgccatgcggaagctg
tggggtaggagtgggcttccctgcaaaaagcaggcctaa

KEGG   Miniopterus natalensis: 107526996
Entry
107526996         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4K2
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526996
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107526996
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107526996
NCBI-ProteinID: XP_016055108
LinkDB
Position
Unknown
AA seq 317 aa
MDVANKSTVSEFVLLGLSDSWELRMFFFMVFSLFYVAAMVGNSLIVITVVADSHLHSPMY
VLLTNLSIIDMSLASFATPKMITDYFTGHKTISFDGCIAQIFFLHLFTGTEIILLMAMSF
DRYIAICKPLRYASILSPQVCVALVVASWVVGVMHSMSQVIFALTLPFCGPNDVDSFFCD
LPVVFQLSCVDTYVLGLFMISTSGIIALSCFILLFNSYVIVLVTIKNHSSRGSSKALSTC
TAHFMVVFMFFGPCIFIYMWPLSSFLVDKILSVFYTIFTPILNPVIYTLRNQEVKTAMRK
LKNRLLHSNKATPLHYF
NT seq 954 nt   +upstreamnt  +downstreamnt
atggatgtagccaataaatctactgtttccgaatttgttttgttgggactctctgattcc
tgggaactacggatgtttttcttcatggtgttttcattgttttatgtggcagcaatggtg
ggtaatagcctcatagtcatcacagttgtagctgactctcacctacactctcctatgtat
gtcctgcttaccaacctttccatcattgatatgtctcttgcttcctttgccacccctaag
atgattacagactactttactggacacaaaaccatctcctttgatggctgcatcgctcag
atatttttcctacacctttttactggtacggagataattttacttatggctatgtccttt
gacaggtatattgcaatatgtaagcctctccgctatgcttcaatcttaagtccccaggtg
tgtgttgcccttgtggtggcttcctgggttgtgggagtcatgcattcaatgagccaggtc
atatttgctctcactttaccattctgtggtcccaatgatgtggacagctttttctgtgac
cttcctgtagtattccagttgtcttgtgtggatacttatgtcttgggcctctttatgatc
tctacaagtggcataattgccttgtcctgctttattcttttatttaattcttatgttatt
gtcctggttactatcaagaatcattcttcacgagggtcgtctaaggctctttccacctgc
acagctcatttcatggttgtcttcatgttctttgggccctgcatcttcatctatatgtgg
ccactaagcagttttttagtagacaagatcctgtctgtgttttataccatctttactccc
attctgaatccagtaatctatacattgagaaatcaagaagtaaagacagccatgaggaaa
ctgaaaaataggcttctacattccaacaaggcaactcctttgcattatttttag

KEGG   Miniopterus natalensis: 107526997
Entry
107526997         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4K2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526997
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107526997
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107526997
NCBI-ProteinID: XP_016055109
LinkDB
Position
Unknown
AA seq 319 aa
MEGFNHSRVSEFVLLGLTDSPELQIFFNVIFSIFYLMTMLGNCLIVLTVLSTPHLHSPMY
FLLSNLSLIDMCLSSFATPKMIMDFFAQRKTISFEGCISQIFLLHLFTGTEIVLLISMSF
DRYIAICKPLRYSAIMSQRVCVVLVVTSWTVGFLHTMSQLAFTLYLPFCGPNIIDSFFCD
LPLVIQLACIDIYVLGIFMISTSGVIALISFLLLLTSYIIVLVTIKDHSSTGSSKALSTC
MAHIIVVLMFFGPCIFIYVWPFTSFLVDKVLSVFYTIFTPFLNPLIYTLRNQEVKTAVMK
KLSNQYLYLGKTTPRYPVQ
NT seq 960 nt   +upstreamnt  +downstreamnt
atggaggggttcaaccattccagagtgtctgaatttgtgttacttggacttactgattct
cctgagctccagattttcttcaatgtgatattttccattttctatttaatgaccatgttg
ggcaactgcctgattgtgctcacggtcctgtccaccccacaccttcattcccccatgtac
ttcctactcagcaatctgtccctcattgacatgtgcctgtcctcctttgccactccaaag
atgatcatggacttctttgctcagcgcaagaccatctcctttgagggctgcatttctcag
atcttcttattgcacctcttcactgggactgagattgtgctgctgatctccatgtctttt
gacaggtacattgccatatgcaaacctctccgttattcagccatcatgagccaaagagta
tgtgttgtgcttgtggtaacttcttggacagtgggtttcctgcatacaatgagccagtta
gcttttactctctatttacccttctgtgggcccaacattatagacagtttcttctgtgac
cttcctttggtcatccagctggcttgtatagatatatatgttcttgggatcttcatgatc
tcaaccagcggtgtgattgctcttataagttttctgcttttgcttacctcttacatcatt
gttctggttactatcaaggaccactcttccacaggatcatctaaggctctttctacctgc
atggcacatatcattgttgtgttaatgttctttgggccctgcatcttcatctatgtgtgg
cctttcacaagcttcctggtggataaagttctctctgttttctataccatcttcacgccc
tttttgaatccacttatctatactttgagaaatcaggaagtgaaaacagctgtgatgaag
aaactaagtaaccaatatttatatcttgggaaaactactccaagatatccagtgcagtga

KEGG   Miniopterus natalensis: 107526998
Entry
107526998         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory receptor 4Q3-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526998
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107526998
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107526998
NCBI-ProteinID: XP_016055110
LinkDB
Position
Unknown
AA seq 318 aa
MKKNNSKVTEFVLLGLSSSWELQLFLFLIFLLFYVATVLGNLLIVVTVRADAHLHQSPMY
YFLGYLSFIDLCLSCVTVPKMLGDFLHQGKAISFSGCLAQIYFLHFLGATEMFLLTAMAY
DRYVAICNPLHYLTVMNRQLCFQLVFACWCGGFIHSITQVTLVIQLPFCGPNELDNFYCD
VPQVIKLACVDTYVVEVLMVSNSGLLSLVCFLVLLFSYIVILITLRTRFRQGQGQGQGQR
KALSTCASHLTVVSLIFVPCVFIYLKPFCSFSVDKVFSIFYTVITPMLNPIIYTLRNADM
KTAMKKLSXKACGILLLC
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaaaaaaaacaattcaaaggtgacagaatttgttcttctgggcctatcatcctcatgg
gagctgcagctgtttctcttcttaatatttttgttgttttatgtggctactgtcctggga
aacctcttgatagtggtaacagtgcgagctgacgctcacctacaccaatctcctatgtac
tattttttgggctatctgtccttcattgacctatgcctgagctgtgtgactgtgcccaag
atgttaggagatttcctacatcagggcaaggccatctctttttccggatgcctggctcag
atctacttcctgcactttctaggagccactgagatgtttctgctgacagccatggcctat
gataggtatgttgccatatgcaatcctttgcactacctcacagtcatgaaccgccagctg
tgcttccaactggtttttgcctgctggtgtgggggtttcatccactctatcacacaggtc
acactggtcatccagctgcccttctgtggccccaatgaactggacaatttctactgtgat
gtcccgcaggtcatcaagctagcctgcgtggacacatatgtggtagaggttctgatggtc
tcaaacagtggtctgctctctcttgtctgcttcttggtcttgctcttctcttacattgtc
atcctcatcaccctgagaacccgcttccgccagggccagggccagggccagggccagcgc
aaggccctctctacctgtgcctcccacttgacagtagtcagcctgatcttcgtgccatgt
gtattcatctacctgaagccgttctgcagcttctctgtggacaaggtgttctccatcttt
tacacagtgatcacacctatgctgaaccccatcatctacacactcagaaacgctgatatg
aagacagccatgaagaagctgagcnaaaaggcatgtggcatcctgctgctatgttga

KEGG   Miniopterus natalensis: 107526999
Entry
107526999         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 11G2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107526999
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107526999
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx Spc110_C DUF2120 DUF4231
Other DBs
NCBI-GeneID: 107526999
NCBI-ProteinID: XP_016055112
LinkDB
Position
Unknown
AA seq 317 aa
MNVSGREPTHSVSHFILMGFPSSPERQLLYFGLFSVAYTLTLMGNTAIACAVWWDRRLHT
PMYILLGNFSFLEICYVTTTIPNMLANFLSTSKAISFVSCFAQFYFFFSLGCDEGFFLCI
MAFDRYLAICRPLHYPHIMTKQLYTGLIVFGWSCGFMLFLTPVVLISQLPFCGPNTINHF
ICDPVPLMMLSCSEDMTTQFIYSTFNAIFIVGTFLFVLCSYALVILAVLRMPSAASKHKA
FSTCASHLAVVILFFGSVIVMYVSPGSGHSVEMQKIVTLFYSVITPLCNPLIYSLRNKEM
KAALRKVFGTKIPVHKT
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaatgtgtccggcagagaacccacccactctgtgagtcactttatcctcatgggcttt
ccctcgagcccagaaaggcagctcctctacttcgggctgttctcggtagcctacaccttg
accctgatggggaacacagccattgcctgcgctgtgtggtgggaccggcgccttcacacc
cccatgtacatcctcttggggaatttctctttcctggaaatatgttatgtcaccacgacc
atccctaacatgttggccaacttcctctccacgagcaaggccatctcctttgtgagctgt
tttgcacagttctacttcttcttctctttagggtgtgatgagggcttcttcctttgcatc
atggcttttgacaggtacctggccatctgccgtcctctgcattacccacatatcatgact
aaacagctatacaccggcctcatcgtctttggatggtcatgtgggttcatgctcttccta
accccagttgttctcatttcacagttgcccttttgtggcccaaacaccatcaaccatttt
atctgtgatcctgtcccactgatgatgctgtcctgttcagaagacatgactacacagttc
atttactctacattcaatgctattttcatagttggcacatttctctttgtcctttgctcc
tatgctctggtgattctggctgtgctgcgaatgccctcagcagcgagcaaacacaaggct
ttctccacctgtgcgtctcatctggctgtggtgatcctgttttttggctctgttattgtg
atgtatgtgagtcctggatctggacactcagtggaaatgcagaaaattgtgaccttgttt
tattctgtgataacacccctgtgcaatcctctgatttatagcctcaggaacaaggagatg
aaggctgccctaaggaaagtctttgggactaaaatacctgttcataaaacataa

KEGG   Miniopterus natalensis: 107527000
Entry
107527000         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 11G2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527000
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527000
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527000
NCBI-ProteinID: XP_016055113
LinkDB
Position
Unknown
AA seq 313 aa
MRTLETTNVSGFVSEFVLLGFPCRRDTQIFLFVLFSFIYLLILLGNTSIICAVWSSPKLH
TPMYTLLANFSFLEICYVSSDVPQMLANIISQTKSISYAGCLLQFYIFFSMCAAEGLFLS
VMAFDRFLAICRPLHYPAIMTHSLCARLVASCWAGGFLWLLTPLILISQVPFCGPNIIDH
FLCDLAPLLALSCAPVPGITLTCGIISSLIIFLTFLYIIGTYCCVINVVLQVPSGSGRHK
ALSTCASHLAVVSLFYGSVMVMYVSPGSGDSPGMQKFVTLFYALATPFFNPLIYNFRNKD
MKDALKKILNVLL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaggactttggagaccactaacgtctctgggtttgtgagtgagttcgtcctcctgggc
tttccctgtcgcagagacacccagatcttcctctttgtgctcttctccttcatttacctt
ctgatcctcctggggaacacatccatcatctgtgcggtatggtcaagccccaaactccac
acacccatgtacaccctcctggccaacttctcctttctggagatctgctatgtcagttcc
gatgtgccccaaatgttggccaacatcatctctcagaccaagagcatctcctacgctggc
tgcctgctccagttttacatcttcttctccatgtgtgctgctgaaggcttgttcctgtcg
gtgatggcttttgatcgatttcttgccatttgtaggcctttgcactaccccgccataatg
acccacagcctgtgtgctcggttagtggcctcctgctgggcgggtggctttctctggtta
ctgactcctttgattctaatatctcaggtgcccttctgtggtccaaacatcatcgaccat
tttctctgtgatctggcacctttgctggcattgtcctgtgctccagtacctggaattact
ctgacctgtggtatcattagctctctcatcatctttctcacttttctgtacatcattggc
acttactgctgtgtcatcaatgtggtgctccaggtgccctcgggctcaggaaggcataaa
gctctctctacttgtgcctcccaccttgctgtggtgtctttgttctatggctcagtcatg
gtgatgtacgttagcccaggttctggggactcccctggtatgcagaaatttgtgaccttg
ttctatgctttggcgactccattctttaatccccttatctacaacttccggaacaaagat
atgaaggatgcactaaagaaaattctgaatgtattattgtga

KEGG   Miniopterus natalensis: 107527001
Entry
107527001         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 11H4-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527001
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527001
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527001
NCBI-ProteinID: XP_016055114
LinkDB
Position
Unknown
AA seq 356 aa
MADVENPAIGLAFATTAAAKLEPQTPVTPGEELTHIPNFFWVKLLPRSKNLSHPVREFVL
LGFPCRWEIQIFLFSTFLVTYMLTLFGNMAIVCAVRWDLRLHTPMYILLANFSFLEICYV
NSDVPNMLANFLSQAKTISFAGCLLQLYFFFSLGTTECLFLSIMAYDRFLAICRPLHYPS
VMTVKFCGRLVIFCWVYGFLWFLIPVIFITQLPFCGPNVIDDFLCDLGPLLALASACVPV
PGTVLMCGTMSSLLIFATFFYIIGSYTLVLRAVMQVPSVAGRKKAFSTCSSHLAVVFLFY
GSVMMTYVSPGAGQAESMQKFTTLFYSVLTPFFNPMIYSLRNKEMKDALKKVLRGS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggctgatgtagagaatcctgctatcggcttagcatttgctacaactgcagctgcaaag
ctggaaccgcagaccccagtcacaccaggagaagagctgacccatattccaaacttcttc
tgggttaaacttttgcctaggtcaaagaatctttctcaccctgtgagggagttcgtcctc
ttgggcttcccttgccgctgggaaatacagatcttcctcttttccaccttcctcgtgact
tacatgctgaccctctttggcaacatggccatcgtgtgtgcagtgcgctgggacctccgg
ctccacaccccgatgtacattctgctggccaacttctccttcctggagatctgctacgtc
aactcggatgtgcccaacatgctggccaacttcctctcccaggccaaaaccatctccttc
gctgggtgcctgctccagctctacttcttcttctccctgggcacaaccgaatgcttattt
ctctccatcatggcctacgaccggttcctggccatctgccgccccctgcactaccccagt
gtcatgactgttaagttctgcggcagactggtcatcttctgctgggtgtatggtttcctc
tggtttctgatcccggtgatattcatcacccagctaccattttgtggcccgaatgtgatt
gatgactttctgtgtgacctgggtcctctgctggccctggcttcagcctgtgtcccagtt
ccagggactgtcctcatgtgtggcaccatgagctccctcctcatctttgccacctttttc
tatattattggctcctacaccctggtgctgagggccgtgatgcaggtgccctctgtagct
ggccggaagaaggccttctccacctgctcctcacacctggctgttgtgtttttattctat
ggttctgtcatgatgacatatgtaagcccgggggcaggacaagcagagagcatgcagaag
ttcaccactttgttctactcagttttgaccccttttttcaaccccatgatctacagcctg
aggaataaagaaatgaaggatgccttgaagaaagttctaagaggttcctaa

KEGG   Miniopterus natalensis: 107527002
Entry
107527002         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory receptor 11H7-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527002
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527002
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DUF4231
Other DBs
NCBI-GeneID: 107527002
NCBI-ProteinID: XP_016055115
LinkDB
Position
Unknown
AA seq 314 aa
MNKSGMSTVTQFVLMGFPGPWKMQILLFXMILFTYVLTLTGNMAIICAVRWNNRLHTPMY
ILLANFSFLEIWYVTCTVPNMLVNFLSKTKTISFSGCFIQFFFFFSLGTTECLFLCVMAY
DRYLAICHPLHYSSIMTGQLCAILVSFCWFVGFLGHSIPIIFISQLPFCGPNIIDHFLCD
VGPLIALSCTLRPIIEHVFHSVSSLIIIFTMLYILGSYILVLRAVIRIPSSAGQQKAFST
CGSHLVVVSLFYGTIMVMYVSPTSGNSVTMHKIITLIYSVVTPLLNPLIYSLRNRDMKFA
LRQVLCGMRIFQTS
NT seq 945 nt   +upstreamnt  +downstreamnt
atgaataagtcaggaatgtctactgtgacacagtttgtcttgatgggctttcctggtccc
tggaaaatgcaaatcctcctttttncaatgattttgttcacctacgtcttgactctgact
gggaatatggccatcatttgtgcagtgaggtggaacaacagactccatacccctatgtac
attctcctggctaacttctccttcctagagatttggtatgtcacctgcacagtccccaac
atgctggtcaattttctttccaaaaccaagaccatatccttctctggttgcttcattcaa
ttctttttctttttttccctgggcacaactgaatgcctcttcctctgtgtcatggcttat
gatcgatacctggccatctgccatccattgcactattcctccatcatgactggacagctc
tgtgccatcctggtgtctttttgttggttcgttggtttccttggacattcaattcccatt
atcttcatttctcaactacctttttgtggtcccaacatcattgaccactttctctgtgat
gtaggcccactgatagcattatcctgtacccttagacccatcatagagcatgtattccat
tctgtgagctctcttatcatcattttcaccatgttgtacatcctaggatcatacatcctg
gtgctcagagctgtgattcggattccttcgtcagctgggcagcaaaaggccttctctacc
tgtggatcccacttagttgtggtttctctgttctacggaaccataatggtgatgtatgta
agtcccacatctggcaactcagttactatgcataagatcatcacactgatatactctgta
gtgacaccactcctaaaccctctcatctacagcctacgtaacagggacatgaaattcgcc
ctccgtcaggtcctttgtggaatgagaattttccaaacttcatga

KEGG   Miniopterus natalensis: 107527021
Entry
107527021         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4F3/4F16/4F29-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527021
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527021
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527021
NCBI-ProteinID: XP_016055123
LinkDB
Position
Unknown
AA seq 306 aa
MDGGNHSVVSEFLLLGLTSSWEIQILLFLFFTIIYIATMLGNLLIVLTIISDHHLHSPMY
FFLANLSLIDMGVSSTATPKMVYDLFRKRKVISLKGCITQMFFIHTVGGTEMVLLMVMAY
DRYIAICKPLHYLTTMSLRTCVSLLAVAWTIGLIHSVAQLAFVVNLPFCGPNQMDSFYCD
FPLFIKLACADTAGLGFLVIANSGFISMGTFIVLIVSYSFILVTVRKHSSGGSSKALSTL
SAHITVVVFFFGPCIVVYVRPFPTLPYIDKFLAIFDALITPFMNPIIYTFRNKEMKVAMR
RLFGKV
NT seq 921 nt   +upstreamnt  +downstreamnt
atggatggaggaaatcactcggtggtgtctgaatttttgttgctgggactcaccagttcc
tgggagattcagattcttctttttctgttcttcacaataatttatatagcaactatgcta
ggaaaccttctcattgtgctcacaatcatctcagaccatcacttacattcccccatgtac
tttttcctggcaaatctctccctcattgacatgggtgtttccagcactgcaaccccgaag
atggtttatgaccttttcagaaaacgtaaagtcatctccttgaaagggtgcattactcag
atgttctttattcacactgttgggggcacagagatggtgctgctcatggtgatggcctat
gaccgatacattgcgatctgtaagcccctccactacttgaccaccatgagcctaagaacg
tgcgtttctcttttggctgttgcttggaccatcgggctcatccactctgtggcccaactg
gcttttgttgtaaacttacccttttgtggtcccaaccaaatggatagcttttattgtgat
tttcctctgttcatcaaacttgcatgtgcagacacagctggattggggtttctggtcatt
gccaacagtggtttcatctccatgggcaccttcattgtcttaattgtctcttacagcttc
atcttggtcacggttcgcaaacactcctcaggtggttcgtccaaagccctctccactctc
tcagctcacatcactgtggtggtttttttctttggtccctgcattgttgtctatgtgcgg
ccattccctaccttaccgtacatagataaatttttagccatttttgatgcccttatcact
ccttttatgaatcctattatctatacatttagaaataaggagatgaaggtggcaatgagg
agactgtttggtaaggtctga

KEGG   Miniopterus natalensis: 107527022
Entry
107527022         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4F6-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527022
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527022
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527022
NCBI-ProteinID: XP_016055124
LinkDB
Position
Unknown
AA seq 311 aa
MDEANHSVVSEFVFLGLSSSWEIQLLLFLFSSVFYAASLTGNLLIVLTVTSDPHLQSPMY
FLLANLSILDLIFCSSTAPKMIYDLLRKCKTISFGGCVTQIFFIHAVGGTEMVLLIAMAF
DRYVAICKPLHYLAIMSPRRCILLLVTSWVIGLIHSVTQLAFVVDLPFCGPNELDSFFCD
LPQFIKLACIETYTLDFMVTANSGFISVVSFLILIISYIFILVTVQKKSSGNSMSKALST
LSAHVAVVFLFFGPLIFFYTWPFSTSHVDKFLAIFDAVLTPFLNPVIYTFRNKEMKVAMR
RLCTQLGIKVS
NT seq 936 nt   +upstreamnt  +downstreamnt
atggatgaagccaaccactctgtggtgtctgagtttgtgttcctgggactctccagttca
tgggagatccaacttctcctcttcctcttttcctctgtgttctatgcggcaagcctgacg
ggaaacctcctcattgtgttaactgtgacctctgaccctcatttacagtcacccatgtac
ttcctgctggccaacctttccatccttgacttgatattttgctcttccacagctcccaag
atgatttacgatcttttaagaaagtgcaaaaccatctcctttgggggctgtgtaactcag
atcttctttatccatgcagttggaggcactgagatggtgctgctcatcgccatggccttt
gatagatacgttgccatatgtaagcctctccactacctggccatcatgagcccgagaagg
tgcattttacttctagtcacttcctgggttattggccttattcattcagtgactcaattg
gcttttgttgtagacttgcccttctgtggccctaacgaattggacagctttttttgtgac
cttcctcaatttatcaaacttgcttgcatagagacttatacattggactttatggttact
gccaacagtggctttatttctgtggtttcctttttaattctgattatctcttacatcttt
atattggtgactgttcagaaaaaatcttcgggtaacagcatgtccaaggctctctccact
ctgtcagctcatgtcgctgtggtgtttttgttctttgggccattaatcttcttctacacg
tggccattttccacatcacatgtggataagttccttgccatctttgatgcagttctcact
ccttttctaaatccagtcatctacacttttaggaataaagagatgaaggtggcaatgagg
agactatgcactcagttgggaattaaagtttcttaa

KEGG   Miniopterus natalensis: 107527023
Entry
107527023         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4F15
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527023
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527023
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527023
NCBI-ProteinID: XP_016055125
LinkDB
Position
Unknown
AA seq 311 aa
MDGMNHSTVTEFVFLGLTNSWEIQLLLFVVSFLFYLAGMTGNLVIVFTVTLDARLHSPMY
FFLANLSVIDMFFCSITAPKMICDIFKKHKAISFWGCITQIFFSHAIGGTEMVLLTAMAF
DRYVAICKPLHYLTIMSPRICIYFLVTSWVVGFIHSLVQLIFVVDLPFCGPNVLDSFYCD
LPRLLRLACTNTQELEFMVTVNSGLISVGSFVLLVISYIFILFTVWKYSSGALFKALSTL
SAHITVVVLFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKEMKVAMKR
LYSHLVHYRKI
NT seq 936 nt   +upstreamnt  +downstreamnt
atggatggaatgaatcactccacagtcacagagtttgtgttcctgggactcaccaattca
tgggagattcaacttctcctttttgtcgtctcctttttgttctacttggcgggcatgacg
ggaaaccttgtcattgtgttcactgtaaccttggatgctcgtctgcactcccccatgtat
ttcttcctggctaacctctcagtcattgatatgtttttttgctcaatcacagcccctaaa
atgatttgtgacattttcaagaagcacaaagccatctccttttggggatgtattactcag
atcttctttagtcatgctattgggggcactgagatggtgctgctcaccgccatggcattt
gacaggtatgtggccatatgtaagcctctccactacctgaccatcatgagtccaagaata
tgtatatactttttagtcacttcctgggttgttggctttatccattcattggttcaatta
atttttgtggtagatttgcctttttgtggccctaatgtattggacagtttttactgtgac
cttcctcggctcctcagacttgcctgcacaaatacccaagaattggagttcatggttact
gtcaatagtggacttatttctgtgggatcttttgtcttgctggtcatttcctacatcttt
attctgttcactgtttggaaatactcttcaggtgctttattcaaggccctctccactttg
tcagctcacatcactgtggtggttttgttctttgggccgctgatgtttttctacacatgg
ccttctcccacatcacacctggataaatatcttgcaatttttgatgcatttatcactcct
tttctgaatccagtcatctatacattcagaaacaaagagatgaaggtggcaatgaagaga
ttgtacagtcatcttgtgcattacaggaagatttag

KEGG   Miniopterus natalensis: 107527024
Entry
107527024         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4F3/4F16/4F29-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527024
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527024
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527024
NCBI-ProteinID: XP_016055126
LinkDB
Position
Unknown
AA seq 312 aa
MDGANYSVVSEFVFLGLTDSWELQLLLFVFSSTFYVGSMLGNSLIMLTVTSDPHLHSPMY
FLLANLSFIDLGVSSVTSPKMIYDLFRKRKVISFSGCMTQVFFIHVIGGVEMVLLIAMAF
DRYVAICKPLHYLTIMSPRMCIFFLVAAWTTGLIHSVVQLAFVVKLPFCGPNVLDSFYCD
LPRFIKLACTDTYQLELMVTANSGFISVGSFFILIISYIIIILTVQKHSSAGSSKALSTL
LAHITVVVLFFGPLIFVYMWPSPSTHLDKFLAIFDAVLTPFLNPIIYTFRNQEMKVAMRR
VCRQLVNYRKIS
NT seq 939 nt   +upstreamnt  +downstreamnt
atggatggagcgaattactctgtggtgtcagagtttgtgttcctgggactcacggattcc
tgggagctccaacttctcctctttgtgttctcttccacattttatgtgggaagcatgttg
ggaaactccctcattatgctcactgtaacttctgaccctcacttacactcccccatgtac
tttctgttggccaacctctccttcattgatctgggagtttcttctgtcacttctcccaag
atgatttatgatcttttcagaaagcgtaaagtcatttcctttagcggttgcatgactcaa
gtcttcttcatccatgtcattggtggtgtggagatggtgctgctcatagccatggccttt
gacagatacgttgccatatgtaagcctctccactacctgaccatcatgagcccaagaatg
tgcattttctttttagtggctgcctggacgactggccttatccactccgtggttcaattg
gcttttgtggtaaaattacccttctgtggtcctaatgttctggatagcttttactgtgac
cttcctcggttcatcaaacttgcctgcacagacacctaccagctagagctcatggtcaca
gccaacagtggcttcatctctgttggctccttcttcatactgatcatttcctatatcatc
atcattctcactgttcagaaacactcttcagctggttcatccaaggctctgtccacactg
ttagctcacatcactgtggtagtcttgttctttggtcctttgatatttgtctacatgtgg
ccatctccctccacacacctggataagtttttggccatctttgatgcagttctcactccc
ttcctgaatcctatcatttacacattcagaaatcaagaaatgaaggtggcaatgaggaga
gtatgcagacagctagtgaattacaggaagatctcttaa

KEGG   Miniopterus natalensis: 107527026
Entry
107527026         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4F15-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527026
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527026
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527026
NCBI-ProteinID: XP_016055127
LinkDB
Position
Unknown
AA seq 312 aa
MNGANHSVVSEFVLLGLSNSWEIQLLLFFFSCLFYMSSMMANLLIMVTVTSDPYLHSPMY
FLLANLSVIDMIFCSIAAPKMICDLFRKQKVISFGGCVAQIFFSHAVGGTEMVLLIAMAF
DRYVAICKPLHYLTIMSPRMCVLILVVAWTTGLIHSSAQLAFVVNLPFCGPNVVDSFYCD
IPRIIKLACTDTHKLEVMVTANSGFISLGAFFLLLLSYIFLLATLQKHPSGGSAKALSTL
SAHVIVVVLFFGPLIFFYMWPSPATHLDKFLAIFDAVLTPFLNPVIYTFRNREMKMAMRR
VFSQTMGFRKNH
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaatggagccaatcattctgtggtgtctgagtttgtgctcctgggactctccaactcc
tgggagatccagcttcttctttttttcttttcttgtcttttttatatgtctagtatgatg
gcaaacctcctcataatggtcactgtgacttccgatccttatttacactctcctatgtat
tttctgttggccaacctctccgtaattgacatgatattttgctctattgcagcacccaag
atgatttgtgatcttttcaggaagcagaaagtcatctcctttgggggctgtgtagctcag
atcttctttagccatgctgttggaggcactgagatggtgctgctcatcgccatggccttt
gacagatatgtggccatctgtaagcccctccactacctgaccatcatgagcccacgaatg
tgtgttttgattttagtggttgcctggaccactggtctcattcactcttcggcccagttg
gcatttgtggtaaacttgcccttctgtggccctaatgtagtagacagcttttactgtgac
ataccccggatcatcaaactggcttgcacagacacccataagctggaggtcatggtcact
gctaacagtgggttcatttccctgggtgctttcttcttgctccttctctcttacatcttc
ctcctggccactcttcagaaacacccctcaggtggttcagccaaggctctttccacactg
tcagctcatgttattgtggtggttttgttctttgggccactgatttttttctatatgtgg
ccctctcctgcaacacatctggataaatttctagccatatttgatgcagttttaacgcca
tttctaaacccagtcatttatacattcagaaacagagagatgaagatggcaatgagaaga
gtgttcagtcagaccatggggtttagaaaaaatcactaa

KEGG   Miniopterus natalensis: 107527027
Entry
107527027         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4F3/4F16/4F29
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527027
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527027
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527027
NCBI-ProteinID: XP_016055128
LinkDB
Position
Unknown
AA seq 312 aa
MDEKNHSFVSEFVFLGLTHSWEIQLLLLVFSSVLYVASMTGNILIVFSVTSDPHLHSPMY
FLLANLSFIDLGACSVTSPKMIYDLFKKHKVISFGGCIAQIFFIHVIGGVEMVLLIAMAF
DRYVAICKPLHYLTIMNPRMCILFTAAAWALGISHSLFQLAFIVHLPFCGPNVLNSFYCD
LPLFLRLACTDTYKLQFMVTVNSGFICVGSFIILLISYVFILFTVWKHSSGGLSKALSTL
SAHITVVLLFFGPTMFVYTWPHLNSQMDKFLALSDAVLTPFLNPVIYTFRNKEMKAAMKR
VCKNLVTYRKIS
NT seq 939 nt   +upstreamnt  +downstreamnt
atggatgaaaagaatcactcgtttgtgtctgagtttgtgtttctgggactcacccattcg
tgggagatccagcttctcctcctggtgttttcctctgtgctctatgtggcaagcatgact
ggaaacatcctcattgtgttttctgtgaccagtgatcctcatttacactcccccatgtac
ttcctcctggccaatctctccttcattgacttaggagcctgctctgtcacctcaccaaag
atgatttatgaccttttcaaaaagcataaagtcatctctttcggaggctgcattgctcag
atcttcttcatccatgtcattggtggtgtggagatggtgctgctcatcgccatggccttt
gacagatacgtggccatatgtaagcctctccactacctgaccatcatgaacccacgaatg
tgcattttgtttacagctgctgcctgggcccttggcattagtcactcactgttccaactc
gcatttattgttcatttgcccttctgtggccctaatgtcttgaacagcttttactgcgac
cttcctctgttccttagactggcctgtacagatacctacaaattgcagttcatggtgact
gtcaacagtgggtttatctgcgttggttccttcattatactcctcatctcctatgtcttc
atcctgtttactgtttggaaacattcttcaggtggcttatccaaggccctctccactttg
tcagctcacatcactgtagttcttttgttctttggcccaaccatgtttgtctacacatgg
ccacacctcaattcacagatggacaagtttcttgcactctctgatgctgttctcactcct
tttttaaatccagtcatctacaccttcaggaataaagagatgaaggcagcaatgaagaga
gtatgcaaaaacttagtgacctacagaaagatctcttaa

KEGG   Miniopterus natalensis: 107527028
Entry
107527028         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4F15-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527028
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527028
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527028
NCBI-ProteinID: XP_016055129
LinkDB
Position
Unknown
AA seq 312 aa
MNRANYSEVSQFVFLGLSTYRPVQHLLLAFSTVLYVTIVLGNFLVVFIVAFDPHLHSPMY
ILLANLSFIDFCLSTLTVPKMISDLYSGHKTISFQGCVIQMFVLHILGGSEMVLLIVMAL
DRYVAICKPLHYLTVMSPQKCIFLLSGAWVIGLIHSVAQLAFVVYLPFCGPNEIDSFYCD
LPWFIKLACTDTYRMEFMVTANSGLISVATLFLLIVSYIFILVTVWKHSSSGMSKALSTL
SAHITVVVLFFGPCIFIYMWPFPTVPVDKFLAILEFLITPILNPIMYTLRNKDMKMAMRR
LSSQLLSLRKIS
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaacagagcaaattattctgaagtgtctcaatttgtgttcctgggactttctacctat
agaccagtgcagcatctcctcctagccttctctacagtgctttatgtaacaatcgttcta
ggaaacttccttgttgtgtttatagtggctttcgaccctcatttacattcccccatgtac
atccttttagccaacctctcatttattgatttctgtctttctactttaacggttcccaag
atgatatctgacttgtactctgggcacaaaaccatatccttccagggatgtgtcatccag
atgtttgtccttcacatcctggggggatctgagatggtgctgcttattgtcatggcctta
gaccgatatgtggccatatgtaagcccctccactatctgactgtcatgagcccacaaaag
tgcatttttcttctttctggtgcttgggttataggcctcattcactcagtagcccagtta
gcttttgttgtttatttgcctttttgtggtcctaatgagatagatagcttttactgtgac
cttccttggtttatcaaacttgcttgcacagacacctacagaatggaattcatggtaact
gccaacagtgggttaatttccgtggccaccttattcttgttgattgtctcctatatcttc
atcctggtcactgtatggaaacactcttcaagtggtatgtctaaggctctttctactctc
tcggctcacatcactgtggtggttttgttctttggaccatgcatctttatttacatgtgg
ccgtttcccacagtgccagtggataagtttctggccattttggagtttttgattacaccc
attctgaatcctattatgtacacattgaggaacaaagatatgaagatggcaatgagaaga
ctgagtagtcaactcctgagtttgaggaagatctcttaa

KEGG   Miniopterus natalensis: 107527029
Entry
107527029         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4K1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527029
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527029
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527029
NCBI-ProteinID: XP_016055131
LinkDB
Position
Unknown
AA seq 303 aa
MEEVNQSAVSEFIILGLCNSWELQAFLLVIFSSLYLITILGNIFIVLLIITDLHLHSPMY
FLLANLSFIDFCLSSVTTPKMITDFLKAKKTISFGGCMCQIFFGHFFGGSEMMLLVSMAY
DRYVAICKPLHYSNIMNKRMCIVLVMTSWIIGFVHSISQLAMIIKLPFCGPRELDSFFCD
IPLVIKLACMDTYILEMLINADSGVLATICFIQLLISYSHILFTVCLHFKDRASKALSTC
TAHITVVVLFFGPCIFIYLWPLSITWVDKFLAVFYAVITPLLNPAIYTIRNKEIKNAIKR
LRC
NT seq 912 nt   +upstreamnt  +downstreamnt
atggaagaagttaaccagtctgcggtgtcagaatttattatccttgggctttgtaattca
tgggagctccaggccttcctcctggtaatattttcttcactttatttgatcaccatttta
ggcaacatcttcattgtgctcctaatcatcactgaccttcatctccactcccctatgtac
ttcctgttagccaatctttcattcattgacttctgcctttcctcagtcactactcctaaa
atgatcacagactttctcaaggcaaagaagacaatctcttttggaggctgcatgtgtcag
attttctttggacatttctttggagggagtgagatgatgctgcttgtgtctatggcctac
gaccgttatgtggccatctgtaagccacttcattactccaacatcatgaacaaacgaatg
tgcatcgtgttagtaatgacatcatggatcattggctttgtgcattcaataagccaacta
gctatgattataaagctccccttctgtggacccagggaactggatagctttttctgtgat
attccattggtgataaagctagcctgcatggatacctatattcttgaaatgttgataaat
gctgacagtggggtactggcaaccatctgcttcatacagttgctgatatcttactctcat
attctatttactgtctgccttcactttaaggacagggcatccaaggctctctccacctgc
actgcccatatcacagtagtggtgctgttctttgggccttgcatcttcatctatctgtgg
ccactcagcatcacctgggtggacaagtttcttgctgtattttatgcggtcattacacct
ctcctaaatccagccatttacactattagaaacaaagagattaaaaatgccattaagaga
ctacgatgttag

KEGG   Miniopterus natalensis: 107527030
Entry
107527030         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4N5
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527030
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527030
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527030
NCBI-ProteinID: XP_016055132
LinkDB
Position
Unknown
AA seq 308 aa
MESENSTVVTEFILLGLTQSQDAQLLVFVLVLIFYLIILPGNFLIILTIRSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYNGCITQLFFLHFLGAGEMFLLVVMAF
DRYIAICRPLHYSTIMNRRACYALLLALWLGGFTHSIVQVALILHLPFCGPNQLDNFFCD
VPQVIRLACTDTFVVELLMVSNSGLLTLLCFLGLLASYAVILCRVRGHSSEGKNKAFSTC
TTHIIIVFLMFGPAIFIYTRPFRAFPADKVVSVFHTVIFPLMNPVIYTLRNQEVKASMRK
LLSRHMVC
NT seq 927 nt   +upstreamnt  +downstreamnt
atggagagcgagaacagcacagtggtgacagaattcattctccttggtctgacccagtct
caagatgctcaactcctggtcttcgtgctagttttaattttctacctcatcatcctcccg
gggaatttcctcatcattctcaccatcaggtcagaccctggcctcacagcccccctctac
ttctttctgggcaacttggccttcctggatgcatcctactccttcattgtggctcccagg
atgctggtggacttcctctctgagaagaaggtcatctcctacaacggttgcatcactcag
ctctttttcttgcacttccttggagcaggagagatgttccttcttgttgtgatggccttt
gaccgctacatcgccatctgccgtcctttacactattcaactatcatgaaccgtagagcc
tgctatgccttgctgctggctctgtggcttgggggttttactcattccattgtacaagtg
gctcttattctccacttgcctttctgtggccccaaccagctggataacttcttctgtgat
gtgccgcaggtcatcaggctggcctgcacggacacctttgtggtggagctcctgatggtc
tctaatagtggcctgctcaccctcctgtgcttcctggggcttctggcctcctacgcagtc
atcctgtgccgtgtaagggggcattcctctgaagggaagaacaaagctttctccacatgc
accacacacattatcattgtgtttctcatgtttgggcctgccatctttatctacactcgc
ccctttagagctttcccagctgacaaagtggtttctgtctttcacacagtgatctttcct
ttgatgaatcctgtgatttatacccttcgcaaccaggaagtgaaagcttccatgaggaag
ctattgagtcggcacatggtttgctga

KEGG   Miniopterus natalensis: 107527031
Entry
107527031         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4K1
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527031
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527031
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527031
NCBI-ProteinID: XP_016055133
LinkDB
Position
Unknown
AA seq 310 aa
MAHTNESVVSEFVLLGLSNSWDLQLFFFAIFSMVYATSVLGNIMIIVIISSDSHLNSPMY
FLLSNLSFIDICQSNFATPKMLVDFFVEHKTISFEGCMAQIFLLHSFVGSEMMLLVAMAY
DRFIAICKPLRYSTIMNRRLCTIFVFISWAVGILHSVSHVAFTVDLPFCGPNEVDSFFCD
LPLVIQLACMDTYGMEIMTLTNSGLISLSCFLALMISYAIILITVWRRSSSASSKALSTL
TAHITVVILFFGPCIYFYIWPFSRLSVDKFLSVFYTVCTPMLNPIIYSLRNEDVKSALRR
LRNHHVNWKN
NT seq 933 nt   +upstreamnt  +downstreamnt
atggctcacacaaatgaatcagtggtgtctgagtttgtgcttctgggactctctaactcg
tgggatcttcagcttttcttttttgccatcttctctatggtgtatgcgacgtccgtgctg
ggcaacatcatgattattgttatcatttcctctgactcccacttgaattccccgatgtac
ttcctgctcagtaacctttctttcattgatatctgccagtctaactttgcaacccccaag
atgcttgtggactttttcgttgagcacaagactatctcctttgagggttgcatggcccag
atattccttctgcatagttttgttgggagtgagatgatgttgcttgtggctatggcatat
gacagatttatagccatctgtaagcccctacgctatagcacaattatgaatcggcgacta
tgtacaatctttgtgtttatttcctgggctgtgggtattcttcattctgtgagccatgtg
gctttcacagtggatctgccattctgtggccctaatgaggtagacagcttcttctgtgac
cttcccctagtgatacagctggcctgcatggatacctatgggatggaaattatgacacta
actaacagtggtctgatatcactgagctgctttctggccttgatgatttcctacgccatc
attctgatcactgtctggcgccggtcctccagtgcgtcatccaaggcgctttctacatta
accgctcacatcacagtggtgattctgttcttcgggccttgcatttatttctacatatgg
ccttttagcagactttctgtggataagttcctttctgtgttctacactgtttgtaccccc
atgttgaaccccatcatctactctctgaggaacgaagatgttaaatcagccttgcgaagg
ttgagaaatcatcacgtgaactggaaaaactag

KEGG   Miniopterus natalensis: 107527032
Entry
107527032         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4N2
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527032
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527032
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527032
NCBI-ProteinID: XP_016055134
LinkDB
Position
Unknown
AA seq 307 aa
MASENSTVVKEFILLGLTQSRNIQLLVFGLILVFYLIILPGNFLIILTIRSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFLSEQKVISYRNCIAQLFFLHFLGGGEGLLLVVMAF
DRYMAICRPLHYSTLMSPRACYALLLALWLGGFVHSIIQVALILRLPFCGPNQLDNFFCD
VPQVIKLACTDTFVVELLMVFNSGLLTLLCFLGLLVSYAVIICRVQRSCSEGKNKALSTC
TTHLIIIIIMFGPAIFIYTRPFRALPVDKVVSLFHTVIFPLLNPVIYTLRNQEIKASMRR
LLNKHLA
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcgagtgagaacagcacagtggtgaaagagttcattctccttggtctcacccagtct
cggaatattcagctcctggtctttgggctcatcttagttttctacctcatcatcctcccg
gggaatttcctcatcattctcaccatcaggtcagaccctggcctcacagcccccctctac
ttctttctgggcaacttggccttcctggatgcatcctactccttcatcgtggctcccagg
atgctggtggacttcctctctgagcagaaggtcatctcctacaggaactgcatcgctcag
ctctttttcttgcacttcctcggaggaggggaggggttactccttgtggtgatggccttt
gaccgctacatggccatctgccgtcctttacactattcaactctcatgagccccagagcc
tgctatgccttgctgctggccctgtggcttggaggctttgtccactccatcatccaggtg
gccctcatcctccgcttgcccttctgtggccccaaccagctggacaacttcttctgtgat
gtgccgcaggtcatcaagctggcctgcacagacaccttcgtggtagagctcctgatggtc
ttcaacagtggcctgctcacgctcctgtgcttcctggggcttctggtctcctacgcagtc
atcatctgtcgtgtgcaacggtcatgctctgaggggaagaacaaggccctgtccacatgt
accactcatctcattattataattatcatgtttggacctgccatcttcatctacactcgc
ccctttagggccttgccagtggacaaggtggtttctctcttccacactgtgatatttcct
ttgttgaatcctgtgatttatactcttcgaaaccaggaaataaaagcttccatgaggagg
ttgcttaataagcacctagcctga

KEGG   Miniopterus natalensis: 107527033
Entry
107527033         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4N4
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527033
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527033
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527033
NCBI-ProteinID: XP_016055135
LinkDB
Position
Unknown
AA seq 308 aa
MEVENSTVVKEFILLGLTQSRNIQLLVFVLVLIFYIIILPGNFLIILTIRSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFLSEQKVISYRNCIAQLFFLHFLGGGEGLLLVVMAF
DRYMAICRPLHYSTLMSPRACYALLLALWLGGFVHSIIQVALILRLPFCGPNQLDNFFCD
VPQVIKLACTDTFVVELLMVFNSGLLTLLCFLGLLVSYAVIICRVQRSCSEGKNKALSTC
TTHLIIIIIMFGPAIFIYTRPFRALPVDKVVSFFHTVIIPLLNPVIYTFRNQEVKSALRR
LLSRRVVC
NT seq 927 nt   +upstreamnt  +downstreamnt
atggaggtggaaaacagcacagtggtgaaagagttcattctccttggtctcacccagtct
cggaatattcagctcctggtcttcgtgctagttttaattttctacatcatcatcctcccg
gggaatttcctcatcattctcaccatcaggtcagaccctggcctcacagcccccctctac
ttctttctgggcaacttggccttcctggatgcatcctactccttcatcgtggctcccagg
atgctggtggacttcctctctgagcagaaggtcatctcctacaggaactgcatcgctcag
ctctttttcttgcacttcctcggaggaggggaggggttactccttgtggtgatggccttt
gaccgctacatggccatctgccgtcctttacactattcaactctcatgagccccagagcc
tgctatgccttgctgctggccctgtggcttggaggctttgtccactccatcatccaggtg
gccctcatcctccgcttgcccttctgtggccccaaccagctggacaacttcttctgtgat
gtgccgcaggtcatcaagctggcctgcacagacaccttcgtggtagagctcctgatggtc
ttcaacagtggcctgctcacgctcctgtgcttcctggggcttctggtctcctacgcagtc
atcatctgtcgtgtgcaacggtcatgctctgaggggaagaacaaggccctgtccacatgt
accactcatctcattattataattatcatgtttggacctgccatcttcatctacactcgc
ccctttagggccttgccagtggacaaggtggtttcctttttccatacagtgatcattcct
ttgctgaaccctgtgatttatacctttcgcaaccaggaagtgaaatctgccctcaggagg
ttactgagtcggcgtgtggtctgctga

KEGG   Miniopterus natalensis: 107527036
Entry
107527036         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 11G2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527036
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527036
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527036
NCBI-ProteinID: XP_016055138
LinkDB
Position
Unknown
AA seq 318 aa
MKISNDSSIGTGFVLLGFPCPREGRGLLFALFSVVYLLTLLGNGSIICAVRWDQRLHTPM
YVLLANFSFLEICYVTSTVPNMLANFLSDTKVISFSGCFLQFYFFFSLGSTECFFLATMA
FDRYLAICRPLHYPTIMTGRLCTNLVVSCWAFGFLWFLIPIIVISRMSFCGTRVIDHFLC
DPGPLLALTCTRTPVIELTSSTLSSLLLFVPFLCILVSYSLVLQAVLRVPSAAGRRKAFS
TCGSHLVVVSLFYGSVMVMYISPTSEHEAGMQKITTLIYSVVTPLINPVIYSLRNKDMER
AIKKLLGIEVEVWIHGTV
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaaaatctccaacgactccagcatcggcactggcttcgttctcctgggcttcccttgc
cccagggaggggcggggcctcctcttcgcgctcttctccgttgtctacctcctgaccctc
ctgggcaatggctctatcatctgtgctgtgcgctgggatcagagactccacacccccatg
tacgtcctgctggccaacttctccttcctggagatctgctatgtcacctccactgtcccc
aacatgttggctaacttcctctctgacaccaaggtcatctccttctctgggtgctttctc
cagttctactttttcttctccttgggctctacggaatgctttttcttggcgactatggca
tttgatcgctaccttgccatctgccggcctctacactatccaaccattatgactggacgt
ctctgcaccaatcttgtggtcagctgctgggcatttggcttcctctggttcttgattccc
atcatcgtcatctcccgaatgtccttttgtggcaccagagttatcgaccacttcctgtgt
gacccaggccctctgttagccctcacctgtaccagaacccctgtaatagagttaactagc
tccaccttaagttctctgctcctatttgtcccctttctttgtatcctggtgtcctattct
ctggttctacaagctgtgttgagggtcccttcagcagctggacgaagaaaggctttctcc
acctgtgggtcccatctggttgtggtttctcttttctatggctcggtgatggtcatgtat
ataagccccacatcagaacatgaagccggaatgcagaagataacaactttgatttattct
gtggttactccactcattaaccctgtgatatatagtctgaggaacaaagatatggaacgt
gctataaagaaattattaggaatagaagtagaggtgtggatacacggaacagtctaa

KEGG   Miniopterus natalensis: 107527037
Entry
107527037         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 11G2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527037
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527037
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527037
NCBI-ProteinID: XP_016055139
LinkDB
Position
Unknown
AA seq 326 aa
MKISNDSSIGTGFVLLGFPCPREGRGLLFALFSVVYLLTLLGNGSIICAVRWDQRLHTPM
YVLLANFSFLEICYVTSTVPNMLANFLSDTKVISFSGCFLQFYFFFSLGSTECFFLATMA
FDRYLAICRPLHYPTIMTGRLCTNLVVSCWAFGFLWFLIPIIVISRMSFCXFFWFLIPII
IISQMSFCGTRVIDHFLCDPAPLLALTCKKAPVVERVFSILSPLPLIIPFLFIMGSYALV
LRAVLKVPSAAGRRKAFSTCGSHLAVVSLFYGSVLVMYGSPTLEHEAGMQKTVTLFYSVV
TPLLNPVIYSLRNKDMKKALQKLLRI
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaaaatctccaacgactccagcatcggcactggcttcgttctcctgggcttcccttgc
cccagggaggggcggggcctcctcttcgcgctcttctccgttgtctacctcctgaccctc
ctgggcaatggctctatcatctgtgctgtgcgctgggatcagagactccacacccccatg
tacgtcctgctggccaacttctccttcctggagatctgctatgtcacctccactgtcccc
aacatgttggctaacttcctctctgacaccaaggtcatctccttctctgggtgctttctc
cagttctactttttcttctccttgggctctacggaatgctttttcttggcgactatggca
tttgatcgctaccttgccatctgccggcctctacactatccaaccattatgactggacgt
ctctgcaccaatcttgtggtcagctgctgggcatttggcttcctctggttcttgattccc
atcatcgtcatctcccgaatgtccttttgtgntttcttctggttcttgattcccatcatc
atcatctcccaaatgtccttttgtggcaccagagttatcgaccacttcctgtgtgaccca
gctcctcttctagcactcacttgcaaaaaagctcctgtggtggagcgtgtcttctccatt
ttaagtcctctgcccctcatcatcccctttctcttcatcatggggtcctatgctctggtc
ctaagagctgtcctgaaagtcccttcagcagctgggagaagaaaggctttctccacctgt
gggtctcacctggctgtggtttcactgttctatggttcagtgctggtcatgtacgggagc
cctacactggagcatgaagctgggatgcagaagactgtgactctgttttattctgtcgtg
accccgcttcttaaccctgtgatatatagtcttaggaacaaagatatgaaaaaggccctg
cagaaacttctgagaatataa

KEGG   Miniopterus natalensis: 107527038
Entry
107527038         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 11H4
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527038
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527038
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527038
NCBI-ProteinID: XP_016055140
LinkDB
Position
Unknown
AA seq 324 aa
MSFFFIDLRPMNRSATPVVTEFVLLGFPGCWEIQIFLFSLFLVIYVVTLLGNGAIICAVR
WDPRLHTPMYFLLGNFAFLEIWYVSSTVPNMLTNILSKTKAISFSGCFLQFYFFFSLGTT
ECLFLAIMAYDRYLAICHPLHYPTIMTGKFCGMLVSLCWLIGFLGYPVPIFFISQLPFCA
SNIIDHFLCDMDPLMALSCAPAPITEFIFYTQSSLVLFFTIMYILRSYCLLLRAVFKVPS
AAGRRKAFSTCGSHLAVVSLFYGTVMVMYVSPTYGIPALMQKILTLVYSVMTPLFNPLIY
SLRNKDMKLALRNVLLRMRISQIS
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtctttcttcttcatagatttaaggcccatgaacaggtcagcaacccccgttgtgact
gagtttgttctcctcggattccctggctgctgggagatacagattttcctcttctcactg
tttctggtgatttatgtcgtgaccttgctggggaatggagccattatctgtgcagtgagg
tgggacccccgactgcacacgcccatgtactttctgctgggcaactttgccttccttgag
atctggtatgtctcctccactgttcctaacatgctaaccaacattctctccaaaaccaag
gccatctcattttctggctgcttcctccagttctatttcttcttttccctcggcacaaca
gaatgtctcttcctggcaataatggcttatgatcggtacctggccatctgccacccgctg
cactaccccaccatcatgactgggaagttctgtggcatgctggtgtccctatgctggctc
attgggttccttggctacccagtccccattttcttcatctcccaactccccttctgtgca
tccaatatcattgatcacttcctgtgtgacatggacccactgatggctctgtcctgtgct
ccagcccccattaccgaatttattttctatactcagagctcccttgtcctctttttcact
attatgtatattcttcgatcctattgtctgttgctcagggctgtttttaaggtcccttct
gccgctggccggagaaaggccttttctacctgtggttctcatttagctgtggtgtctctt
ttctatgggacagtcatggtaatgtatgtgagccctacctatggcatcccagctttgatg
cagaagatcctcacactggtatattcagtaatgactcctctctttaatcccctgatctat
agtcttcgtaataaggacatgaaacttgctctgagaaatgttctattgagaatgagaatt
agtcaaatttcatga

KEGG   Miniopterus natalensis: 107527042
Entry
107527042         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 6S1
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527042
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527042
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527042
NCBI-ProteinID: XP_016055145
LinkDB
Position
Unknown
AA seq 331 aa
MAPDGNQSSGVTEFILAGIPNLNSTKEELFSVFLLVYLLTLTGNVLIVGVVGADTRLQTP
MYFFLGNLSCLEILLASVIIPKMLSNFLSRQHTISFAACITQFYFYFFLGASEFLLLAVM
SVDRYMAICHPLHYPLLMNGTVCFRVALACWMGGLLPVLGPTVAVALLPFCEQDAVVQHF
FCDSGPLLRLACTNTKKLEETDFILASLVIVSSLMITAVSYGHIVLAVLRIPSASGRQKA
FSTCTSHLMVVTLFYGSAIFLYVRPSQSGSVDTNWAVTMVTTFVTPLLNPFIYALRNERV
KEALKDIFRKVVVGFWGDLLLAKSFNKKIMR
NT seq 996 nt   +upstreamnt  +downstreamnt
atggctcctgatgggaaccagagcagtggtgtgacagagttcattctggcaggtatccca
aatctcaacagcacaaaagaagaattgttttctgtcttccttcttgtttatctgctgact
ctaacaggcaatgtgttgattgttggggtggtaggagctgatactcgcttgcagactccc
atgtacttctttctgggaaacctgtcctgcctagagatcctgctcgcttccgtgatcatt
cccaagatgctgagcaattttctttcaaggcaacacactatttcttttgctgcatgtatt
acccaattctatttctacttctttcttggggcctctgagttcttgctgctggctgtcatg
tctgtggatcgctatatggccatctgtcaccctctgcactaccccttgctcatgaatggt
actgtgtgctttcgggtggccttggcctgctggatgggagggctcctccctgtgcttggc
cccacagttgctgtggccttgcttcctttctgtgaacaagatgctgtggtgcagcacttc
ttctgtgacagtggcccactgctccgcctggcatgcaccaataccaagaagctggaggaa
actgactttatcctggcctctcttgtcattgtatcctcactgatgattactgctgtgtcc
tatggccacatagtcctggctgtcctgcgcatcccctctgcttcaggccgtcagaaggcc
ttctctacctgtacctcccacttgatggtggtgaccctcttctatggaagtgccattttt
ctctatgtgcggccatcacagagtggctctgtggatactaattgggcagtgacaatggta
acaacatttgttacaccactgctgaatccatttatctatgccttgcgtaatgagcgagtc
aaggaagctttgaaggatatttttagaaaggtggtagtaggcttctggggggatctttta
cttgctaagagtttcaacaagaaaataatgaggtga

KEGG   Miniopterus natalensis: 107527050
Entry
107527050         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5AU1
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527050
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527050
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527050
NCBI-ProteinID: XP_016055155
LinkDB
Position
Unknown
AA seq 338 aa
MRSSELPRCATSFLVVSTFHAPQHLRNMEGANLSQGVEFELLGLTSDPQLQTLLFVVFLG
MYIVTLLGNLIMFLLIHVSATLNTPMYSLLKSLSFLDLCYSSTVVPQTLVNFLAKRKVIS
YLGCMAQMFFYAGFATSECYLIAAMAYDRYAAICNPLLYPVTMSPEVCASLIVGSYCAGF
LNSLIHTSCIFSLKFCGAHVVTHFFCDGPPILSLSCVNTLLCEILLFIFAGFNLLNCTLT
ILVSYLLILITILRMNSAQGRFKAFSTCASHLTAVCLFYGTTLFMYLRPKSKYSLAQDRI
VAVIYTVVIPMLNPLIYSLRNKDVKKALRKVWSREIME
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgagatcatctgaattacccaggtgtgccacgtcatttctggtggtctccactttccat
gccccacagcacttgaggaatatggaaggggcaaacctgagccaaggggtggagtttgag
ctcttgggcctcaccagtgacccccagctccagacactgctcttcgtggtgttcctgggc
atgtacatcgtcactctgctggggaacctgatcatgttccttctcatccatgtgagtgcc
accctgaacacgcccatgtactccctcctgaaaagcctgtccttcttggatttgtgctac
tcctccacggttgtcccccagacgctggtgaacttcttggccaagaggaaggtgatctcc
tatcttggctgcatggctcagatgttcttctatgctggtttcgccaccagtgagtgctat
ctcattgctgccatggcttacgaccgctacgctgctatttgcaaccccctgctctaccct
gtcaccatgtctcctgaggtctgtgcctctctgattgtaggctcctactgtgcaggattc
ctcaattctcttatccacacaagctgtatcttcagtttgaaattctgtggtgctcacgtg
gtcactcacttcttctgtgatggacctcccattctgtctctgtcttgcgtgaacaccctg
ctgtgtgagatcctgctctttatttttgctggtttcaaccttttgaactgcacccttacc
atcttggtttcctacctcttaattctcatcaccatcctgagaatgaactcagcccagggc
aggttcaaggccttttccacctgtgcttcccacctcactgctgtgtgtctcttctacggc
acaacactttttatgtacctgcgccccaagtccaaatactccctggctcaagatcgcata
gttgcagtgatctacacggtggtgatcccaatgctgaacccccttatctattctttgaga
aacaaagatgtgaagaaagccttaagaaaggtttggagcagggaaataatggaatga

KEGG   Miniopterus natalensis: 107527052
Entry
107527052         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 10G3
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527052
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527052
SSDB
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Other DBs
NCBI-GeneID: 107527052
NCBI-ProteinID: XP_016055157
LinkDB
Position
Unknown
AA seq 313 aa
MERVNSTLLTEFILTGIPYPFRLRIFLFVFFLLIYILTQLGNLLILITVWVDVQLHAHPM
YIFLGVLSIIDMAISTIIVPRFMMNFTSSITPISFGGCVTQLYFYHFLGSTQCFLYTLMA
YDRYLAICRPLHYPVLMNAKLSTLLVAGAWVAGSIHGALQAILTFRLPYCGPNQVEYFFC
DIPAVLRLACADTTVNELVTFVDIGVVVASCFSLILLSYIQIIRAILRIRTADGRRRAFS
TCGAHVTVVTVYYVPCAFIYLRPETNNPLDGAAALFPTAITPFLNPIIYTLRNQEVKLAL
KRMLGGRGTKSQV
NT seq 942 nt   +upstreamnt  +downstreamnt
atggaaagagtcaacagcacattgttgacagagttcatcctgacaggaattccctaccca
ttcaggctaaggatatttctttttgtgttctttttgctgatctacatcctgactcagctg
gggaacttgcttattctaatcactgtttgggtagacgtgcagctccatgctcatcccatg
tacatctttcttggtgttctctccatcattgacatggccatctccaccatcattgttcct
cgtttcatgatgaacttcacttcaagcatcacacccatctcatttggtggctgtgtcacg
caactctatttctatcacttcctgggtagcacccagtgcttcctctacaccctgatggcc
tatgaccggtacctggcaatatgccggcccttgcattaccctgtgctcatgaatgctaag
ctgagtaccttacttgtggctggagcttgggtggcaggatccatccatggggctctccag
gccatcctaaccttccgtctgccctactgtgggcccaaccaggtagagtacttcttctgt
gacatccctgcagttttgaggctggcctgtgctgatacaacagtcaacgagctggtgacc
tttgtagacattggggtggtggttgccagttgcttctccctgattctcctctcctacata
cagatcattcgggcaatcctgagaatccgtacagcggatgggcggcgcagggccttttca
acctgcggagcccatgtaactgtggtaaccgtgtactatgtgccttgtgccttcatctac
ctgaggcctgagaccaacaaccccctggatggggcagctgccttgttccccacagccatc
actccttttctcaaccccatcatctacactctgcggaaccaagaggtgaagttggccctg
aagagaatgctaggaggccgtgggactaagagtcaggtctga

KEGG   Miniopterus natalensis: 107527053
Entry
107527053         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 10G2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527053
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527053
SSDB
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Other DBs
NCBI-GeneID: 107527053
NCBI-ProteinID: XP_016055158
LinkDB
Position
Unknown
AA seq 318 aa
MRKDKNTSLDTVVTDFILLGLPHPPNLRILLFLVFFIIYILTQLGNLLILLTVWADPKLH
ARPMYILLGVLSFLDMWLSSVIVPRIILNFTPSSKAIPFGGCVAQLYAFHFLGSTQCFLY
TLMAYDRYLAICRPLRYPMLMNGKLCTILVAGAWVAGSIHGSIQATLTFRLPYCGPNQVD
YFICDIPAVLRLACADTTVNELVTFVDIGVVAASCFMLILLSYANILHAILKISTADGRR
RAFSTCGSHLTVVTVYYVPCIFIYLRAGSKGPLDGAVAVFYTVVTPLLNPLIYTLRNQEV
KSALRRMTAGRGAASENK
NT seq 957 nt   +upstreamnt  +downstreamnt
atgagaaaggacaaaaacacatccctggacaccgtggtgacagatttcattctcctgggc
ttgcctcaccccccaaatctgaggatccttctcttcctggtcttcttcatcatttacatc
ctcactcagctggggaacctgctcatcctgctcaccgtgtgggctgacccaaagctccac
gctcgccccatgtacatccttctgggtgtgctctcattcctggacatgtggctctcctca
gtcattgttcctcgaattattcttaatttcactccttccagcaaggccatcccatttggt
ggctgtgtggctcagctatatgcctttcacttcctgggcagcacccagtgcttcctctac
accttgatggcctacgacaggtacctggccatatgccggcctctgcgctaccccatgctc
atgaatggcaagttgtgcactatcctggtggctggagcttgggtggctggctccatccac
gggtctatccaagccaccctgactttccgcctgccctactgtgggccaaaccaggtggat
tactttatctgtgacatccccgcagtattgagactggcctgtgccgacacaactgtcaat
gagcttgtgacctttgtggatatcggggtagtggctgccagctgcttcatgttaatcctg
ctctcctatgccaacatattgcacgccatcctgaagataagcaccgctgacgggcggcgg
cgggccttctccacctgtggctcccacctaaccgtggtcacagtctactatgtcccctgt
attttcatctaccttcgggctggctccaagggccccctggatggggcagtggctgtgttt
tacactgttgtcactccattgctgaaccccctcatctacacgctgaggaaccaggaggtg
aagtctgctctgaggagaatgacagcaggtcgaggggctgcaagtgaaaataagtaa

KEGG   Miniopterus natalensis: 107527054
Entry
107527054         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 10G2
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527054
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527054
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527054
NCBI-ProteinID: XP_016055159
LinkDB
Position
Unknown
AA seq 318 aa
MRKDKNTSLDTVVTDFILLGLPHPPNLRILLLLVFFIIYILTQLGNLLILLTVWADPKLH
ARPMYILLGVLSFLDMWLSSVIVPRLILDFTPANKAIPFGGCVAQLYFFHFLGSTQCFLY
TLMAYDRYLAICRPLRYPMLMNGKLCTILVAGAWVAGSIHGSIQATLTFRLPYCGPNQVD
YFICDIPAVLRLACADTTVNELVTFVDIGVVAASCFMLILLSYANILHAILKISTADGRR
RAFSTCGSHLTVVTVYYVPCIFIYLRAGSKGPLDGAVAVFYTVVTPLLNPLIYTLRNQEV
KSALRRMTAGRGAASENK
NT seq 957 nt   +upstreamnt  +downstreamnt
atgagaaaggacaaaaacacatccctggacaccgtggtgacagatttcattctcctgggc
ttgcctcaccccccaaatctgaggatccttctcctcctggtcttcttcatcatttacatc
ctcactcagctggggaacctgctcatcctgctcaccgtgtgggctgacccaaagctccac
gctcgccccatgtacatccttctgggtgtgctctcattcctggacatgtggctctcctca
gtcattgttcctcgtctaatactggattttactcccgccaacaaggccatcccatttggt
ggctgtgtggcacagttgtatttctttcacttcctgggcagcacccagtgcttcctctac
accttgatggcctacgacaggtacctggccatatgccggcctctgcgctaccccatgctc
atgaatggcaagttgtgcactatcctggtggctggagcttgggtggctggctccatccac
gggtctatccaagccaccctgactttccgcctgccctactgtgggccaaaccaggtggat
tactttatctgtgacatccccgcagtattgagactggcctgtgccgacacaactgtcaat
gagcttgtgacctttgtggatatcggggtagtggctgccagctgcttcatgttaatcctg
ctctcctatgccaacatattgcacgccatcctgaagataagcaccgctgacgggcggcgg
cgggccttctccacctgtggctcccacctaaccgtggtcacagtctactatgtcccctgt
attttcatctaccttcgggctggctccaagggccccctggatggggcagtggctgtgttt
tacactgttgtcactccattgctgaaccccctcatctacacgctgaggaaccaggaggtg
aagtctgctctgaggagaatgacagcaggtcgaggggctgcaagtgaaaataagtaa

KEGG   Miniopterus natalensis: 107527056
Entry
107527056         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4E2
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527056
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527056
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527056
NCBI-ProteinID: XP_016055160
LinkDB
Position
Unknown
AA seq 308 aa
MDALNQTRVTEFVFLGLTDNWVLNILFFMAFSAIYVLTLWGNILIMVAIAFTEHLHIPMY
FFLSNLSFIDICHSSVTVPKMLKDLLLERKTISFENCIAQLFFLHLFACAEIFLLTIMAY
DRYVAICAPLHYTNVMNLRVCIQLVFALWLGGTVHSLVQTFLTIRLPYCGPNIIDSYFCD
VPPVIKLACTDTYLTGMLMVSNSGTISLTCFLALVTSYTVILVSLRKQSAEGRWKALSTC
SAHFMVVVLFFGPCIFIYTRPDTSFSLDKVVSVFYTMVTPLLNPLIYSLRNEEVKIAIKH
LCQRQVFS
NT seq 927 nt   +upstreamnt  +downstreamnt
atggatgcactaaaccaaacaagagtgactgaatttgtcttcttgggacttactgataac
tgggtactgaatatattatttttcatggcattctcagccatatatgtgctaactctttgg
ggaaacattcttatcatggttgccatagcttttactgaacatctccatatccccatgtat
tttttcctgagcaatctgtcgtttattgacatctgccactcatctgtcactgtgcccaag
atgctgaaggatttgcttttagagagaaagaccatttcctttgaaaactgcattgcacag
ctcttcttcctacatctgtttgcctgtgctgagatctttctgctgaccattatggcctat
gatcgttacgtagccatctgcgctccattacactacaccaatgtgatgaatctgagggtc
tgcatacagcttgtctttgctctctggttggggggtactgttcactctctggtgcagacc
ttcttgaccattcgtctgccttactgtggccccaacattattgatagctacttttgtgat
gtgcctcctgtcatcaagctcgcctgtacggatacatacctcacgggaatgctgatggtg
tccaatagtggaaccatctccctcacctgtttcctggctttggttacctcctacacagtc
atcttggtttctcttagaaaacagtcagctgaagggcgctggaaagccctgtctacctgc
tcagctcacttcatggtggttgtcctcttctttggaccatgtatcttcatctatactcgg
ccagacaccagcttctcccttgacaaggtggtatctgtcttttacacaatggtcacccct
ttgctgaaccccctcatttacagtttgagaaatgaggaagtaaaaattgccatcaagcat
ctctgccaaagacaagttttttcatga

KEGG   Miniopterus natalensis: 107527594
Entry
107527594         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 1440-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527594
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527594
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527594
NCBI-ProteinID: XP_016055859
LinkDB
Position
Unknown
AA seq 314 aa
MTGRRNSTMINKFILLGFSEFPKLTIVLFSVFLGIYLITVSWNVGLITLIRTDPSLHTPM
YFFLSNLSLLDICYVSTIAPRMLSDFFKKHKSISLMGCTTQYFFFSSLGLTECCLLAAMA
YDRYAAICNPLLYTAIMSPTLCVQMVAASCITGFFGSLIQFCALLQLHFCGPNVINHFFC
DVPQLLILSCSDTFYFQVMMSVLTVIFGLISALVIMISYGYIVATILKITSAEGRCKAFN
TCASHLTAVTLFFGSGVFVYMYPTSGDSQSQNKLASVLYTTVIPMLNPLIYSLRNKEIKD
ALNRWKKRIFSWRY
NT seq 945 nt   +upstreamnt  +downstreamnt
atgactggaagaaggaacagtacgatgattaacaagttcattctcttgggattctctgaa
tttccaaaactcaccattgtcctcttttcagtattcctagggatctacctgataacagtg
tcctggaacgtgggcctcatcaccctcatcaggaccgacccctctctgcacacacctatg
tactttttcctcagtaacctgtccttgctggacatctgctatgtttccactatcgccccc
aggatgctctcagacttcttcaagaagcacaaatccatctccttgatggggtgtaccaca
cagtacttcttcttctctagcctgggtctgactgaatgctgtctcctggcagccatggct
tatgacaggtacgctgccatttgtaaccctctgctctacacggccatcatgtcccccacc
ctctgtgtgcagatggtggcagcgtcttgtataacgggattctttggctcattgatccaa
ttctgcgccttacttcagctgcatttctgtgggccaaatgtcatcaaccatttcttttgt
gacgtgccccagttgctaatcctatcctgctctgacaccttttattttcaagtcatgatg
tctgtgctcacagtgatctttgggctcatatctgccttggttattatgatatcctatggt
tatatcgttgccaccattctgaagatcacttcagctgaaggcaggtgcaaggccttcaac
acctgtgcttctcacctgaccgcagtgaccctcttctttggctcaggcgtctttgtttat
atgtatcctacttctggcgattcccagagccaaaacaagttggcatcggtcttatacact
actgtcatccccatgctaaatccattgatctacagcctgagaaataaggaaatcaaagat
gccctaaacagatggaagaagagaatcttctcctggcgttactaa

KEGG   Miniopterus natalensis: 107527599
Entry
107527599         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5B12-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527599
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527599
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527599
NCBI-ProteinID: XP_016055863
LinkDB
Position
Unknown
AA seq 312 aa
MENSTEVNAFRLLGLTDTPELQVPLFVIFTLIYLITLMGNLGMIALILLDSCLHTPMYFF
LSNLSLVDCAYSSAVTPKVMAGFLTGGKVISYGGCVAQMFFFVAFASADCFLLAVMAYDR
HTAVCKPLRYTSIVTPRVCVQMSVGCYVWGLVESAIHTGFTFCLSFCRSNVVHHFFCDIP
AILALSCSDISINEIVLFILAAFNVLFALTVILTSYLFIFIALLRMRSAEGRKKALSTCA
SHLTAVSIFYGTVIFMYLQPSSSHTLDTDQTASVFYTIIVPMLNPLVYSLRNKEVNNAFR
KAMKKMKVLLST
NT seq 939 nt   +upstreamnt  +downstreamnt
atggagaacagcacagaggtgaatgcgtttagactcttgggactgacagacaccccagag
ctacaggtccccctcttcgtaatattcactctcatctatctgatcacgctcatgggaaac
cttgggatgatcgcgttaattctgttggactcttgcctgcacacgcccatgtacttcttc
ctcagtaacctgtccctggtggactgcgcttactcctcggctgtcacccccaaggtgatg
gcggggttcctcacagggggcaaagtcatctcctacggggggtgcgttgcgcagatgttc
ttcttcgtcgcttttgccagtgcagactgcttcctgctggctgtcatggcttatgatcgt
cacaccgccgtgtgtaaacccttgcgttacaccagcatcgtgacgccccgggtgtgtgtt
cagatgtccgtgggctgctacgtctggggcttggttgaatccgccatccacactggcttc
accttctgcctgtccttctgccgctccaacgtggtccatcactttttctgtgatatccct
gcaatcctggctctttcgtgctctgatatctccatcaacgagatagtgctctttatctta
gcagctttcaatgtcttgttcgccctaacagttatcttgacctcctatctgttcatattc
atcgcccttctgaggatgcgctcagcagaggggcggaagaaggccctctccacctgcgcc
tcccacctcactgctgtctccatcttctatgggactgtcatcttcatgtacctacagccc
agctccagccacaccctggacaccgaccaaacggcatctgtgttctatacaatcatagtc
cccatgttgaaccctcttgtctacagtctgcggaataaagaggttaataatgctttcaga
aaagccatgaagaagatgaaggttctgctcagcacataa

KEGG   Miniopterus natalensis: 107527601
Entry
107527601         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5B3-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527601
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527601
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527601
NCBI-ProteinID: XP_016055864
LinkDB
Position
Unknown
AA seq 314 aa
MGNRTEVTEFTLLGLTSAPDLQVPLFIMFTLIYLISVVGNLGIIILILMDSHLHTPMYFF
LSNLSLVDFCYSTAVTPKVIAGFLIGDKVISYIACAAQMFFFVALATVENFLLASMAYDR
YAAVCKPLHYTSTMTPGVCARLAVGSYICGFLNASVHVRDTFSLSFCMSNLVHHFFCDVP
AVMALSCSDRHIGELILVVVASFNICFALVVILISYMFIFVTILKMHSADGYQKALSTCA
SHLTTVSIFYGTIIFTYLQPSSSHSMDTDKIASVFYTIVIPMLNPLVYSLRNKEVKNAFK
KVVEKAKLSLSFTC
NT seq 945 nt   +upstreamnt  +downstreamnt
atggggaacaggacagaagtgactgagttcaccctcctcggactgaccagcgccccagac
ctgcaggtccccctcttcatcatgttcactctcatctacctcatcagtgtggttggaaac
ctggggataattatcttgattctcatggactctcatctccacactcccatgtattttttc
cttagtaacctctctttggttgacttttgttactctacagctgtcactcccaaggtcata
gctggattcctcataggagacaaggtcatctcctacattgcatgcgctgctcagatgttc
tttttcgtagccttggccactgtggaaaatttcctcttggcctccatggcctatgaccgc
tacgcagcagtgtgcaagcccctgcactacaccagcaccatgacacccggggtgtgtgcg
cgtctggccgtaggttcctacatctgtggttttctgaatgcctctgtccacgttagggac
acattcagcctctctttctgtatgtcgaatctggtccatcactttttctgcgatgttcca
gcagttatggctctctcttgttctgacagacatattggtgagctgattcttgttgtcgtg
gcaagcttcaacatctgttttgctctcgtggttatcttgatttcctacatgttcatattt
gtcaccatcctgaagatgcactcagctgatggatatcagaaggctctgtccacctgcgcc
tctcacctcactacagtctccatcttctatggaactattatcttcacttacttacagccc
agctccagccattccatggacacagacaaaattgcatctgtgttttatactatagtcatc
cccatgctgaaccccctggtctatagcttgagaaacaaggaggtaaaaaatgcattcaag
aaggttgttgagaaggcaaaactgtctctaagcttcacctgttaa

KEGG   Miniopterus natalensis: 107527602
Entry
107527602         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5B2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527602
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527602
SSDB
Motif
Pfam: 7tm_4 7tm_1 tRNA_synthFbeta
Other DBs
NCBI-GeneID: 107527602
NCBI-ProteinID: XP_016055865
LinkDB
Position
Unknown
AA seq 314 aa
MENRTEVTHFILVGLTSAPGLQVPLFIMFTLLYLSTVVGNLGLAVLTLLDPRLHTPMYFF
LRNLALVDFAYSSAVTPKAMAGLLVGDKVISYNGCAAQMFFFVAFATVENYLLASMAYDR
YAAVCKPLHYTTTMTPGVCARLAIGSYVCGFLNAFFHVGDIFSLFFCKSNLVHHFFCDVP
AVMALSCSGIRISEVFLVFMSSFNVSFALLVILISYLFIFITILKIHSAQGHQKALSTCA
SHLTTVSIFYGTVIFMYLQPSSSHSLDTDKVASVFYAMVIPMLNPLVYSLRNKEVKGALK
KVIEKAKFSVGLGF
NT seq 945 nt   +upstreamnt  +downstreamnt
atggagaacaggacagaagtgacacatttcatccttgtgggcctaaccagcgccccaggc
ctgcaggtccccctcttcatcatgttcaccctcctctacctcagcactgtggtggggaac
ctggggctggcggtgctgaccctgctggacccccgcctccacacgcccatgtacttcttc
ctcaggaacctggccctggtggacttcgcttactcctcagctgtcactcccaaggccatg
gccgggttgcttgtaggcgacaaggtcatctcctacaatgggtgcgctgctcagatgttc
tttttcgtagcctttgccactgtggaaaattacctcttggcctccatggcctatgaccgc
tacgcagcagtgtgcaagcccctgcactacaccaccaccatgacacccggggtgtgtgcg
cgtctggccataggctcctatgtctgtggtttcctgaatgccttcttccatgttggggac
atattcagccttttcttctgtaagtctaatcttgtccatcactttttctgtgatgttcca
gcagtgatggctctgtcttgctcaggtatacgcattagtgaggtgtttcttgtttttatg
tcaagctttaatgtgtcttttgctcttctggttatattgatttcctacctgttcatattt
atcaccatcttgaagatacactcagctcaggggcaccagaaggctctgtccacctgcgct
tctcacctcactacagtctccatcttctacgggactgtcatcttcatgtacttacagccc
agctccagccactccctggacacagacaaggtggcctccgtgttctatgccatggtcatc
cccatgctgaaccctctggtctacagcctgaggaacaaagaggtgaagggtgcactcaag
aaggtgattgagaaggcaaaattttctgtggggttgggattttaa

KEGG   Miniopterus natalensis: 107527603
Entry
107527603         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5B2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527603
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527603
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527603
NCBI-ProteinID: XP_016055866
LinkDB
Position
Unknown
AA seq 322 aa
MENRTEVTHFILVGLASAPGLQVPLFIMFTLIYLSTVVGNLGLAVLILLDPRLHTPMYFF
LSNLALVDFAYSSTITPKVMAGFLTGDKVISYNACAAQMFFFIVFATVESYLLASMAYDR
YAAVCKPLHYTTTMTPEVCAGLAIGSYVCGFLNASIHTRDTFSLSFCESNVVHHFFCDIP
AVAALSCSDRHISELILVVVASFNIFFALVVILISYLFIFITILKMPSSSGYQKALSTCA
SHLTAVSIFYGTVIFMYLQPSSSHSLDTDKVASVFYAMVIPMLNPLVYSLRNKEVKGALK
KVVSEAKLIFFRMMILRLCNGQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atggagaacaggacagaagtgacacacttcatccttgtgggactagccagcgccccaggc
ctgcaggtccccctcttcatcatgttcaccctcatctacctcagcactgtggtggggaac
ctggggctggcggtgctgatcctgctggacccccgcctccacacgcccatgtacttcttc
ctcagtaacctggccctggtggacttcgcttactcctcaacaatcacgccaaaggtcatg
gctgggtttctaacaggagacaaggtcatctcctacaatgcctgtgctgctcagatgttc
ttttttatagtctttgccactgtggaaagttacctcttggcctccatggcctatgaccgc
tacgcagcagtgtgcaagcccctgcactacaccaccaccatgacacccgaggtgtgtgca
ggtctggccataggctcctatgtctgtggtttcctgaatgcttccatccacaccagggac
accttcagtctctctttctgtgagtccaatgtggttcatcactttttctgcgatattcca
gcagtcgcagccctttcttgctcagacagacacattagtgagctgattcttgttgtggtg
gcaagcttcaacatcttttttgctctcgtggttattttgatttcctacctgttcatattt
atcaccatcctaaagatgccttcatcttcggggtatcagaaggctctgtccacctgcgcc
tctcacctcactgctgtctccatcttctacgggactgtcatcttcatgtacttacagccc
agctccagccactccctggacacagacaaggtggcctccgtgttctatgccatggtcatc
cccatgctgaaccctctggtctacagcctgaggaacaaagaggtcaagggtgcactcaag
aaggttgtttcagaggcaaaattgattttctttaggatgatgattttacgattgtgcaat
ggacagtaa

KEGG   Miniopterus natalensis: 107527604
Entry
107527604         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5B17-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527604
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527604
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527604
NCBI-ProteinID: XP_016055868
LinkDB
Position
Unknown
AA seq 322 aa
MNSQITPTENNTELRQFILLGLTSAPDLQVPLFIMFTVFYLSTVVGNLGMVVLILLDPRL
HTPMYFFLSNLALVDFAYSSTITPKVMAGFLTGDKVISYNACAAQMFFFIVFATVESYLL
ASMAYDRYAAVCKPLHYTTTMTPGVCACMTTGCYILGFLNASINVGDTFCLSFCMSNVIH
HFFCDVPAVMTLTCSGKHVSELILILISSFNVFLALFVILISYLLIFITISKMHSKGAYQ
KALSTCASHLVTVSIFYGTVIVMYLQPSSSHSLDTDRIASVFYTVVIPMLNPLVYSLRNK
EVKGAFKKVVEKAKLSLFYRNA
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaattcgcaaatcacacccacagagaataatacagagctgagacaattcatcctccta
ggactaaccagcgccccagacctgcaggtccccctcttcatcatgttcaccgtcttctac
ctcagcactgtggtggggaacctggggatggtggtgctgatcctgctggacccccgcctc
cacacgcccatgtacttcttcctcagtaacctggccctggtggacttcgcttactcctca
acaatcacgccaaaggtcatggctgggtttctaacaggagacaaggtcatctcctacaat
gcctgtgctgctcagatgttcttttttatagtctttgccactgtggaaagttacctcttg
gcctccatggcctatgaccgctacgcagcagtgtgcaagcccctgcactacaccaccacc
atgacacccggggtttgtgcctgtatgaccacgggctgctatatccttggcttcctgaat
gcttctattaacgttggagacaccttctgtctctctttttgtatgtccaatgtgatccat
cactttttctgcgatgttcccgcagtcatgactctaacttgctctggaaaacatgtcagt
gaactgattctcattctgatttcaagctttaatgtctttctggcactttttgttatcttg
atttcctacttgttgatatttattaccatttccaagatgcactcaaaaggggcatatcag
aaggctttatctacttgtgcttctcaccttgtgacagtttccatattttatgggactgtc
atcgttatgtacttacagcccagctccagccattccctggacacagacagaatcgcatct
gtgttctatactgtggtcatccccatgctgaaccctctggtctacagcctgaggaacaaa
gaggtcaagggtgcctttaagaaggttgttgagaaggcaaaattgtctctgttttatcgt
aatgcatag

KEGG   Miniopterus natalensis: 107527606
Entry
107527606         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5B12-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527606
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527606
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx GST_C_2
Other DBs
NCBI-GeneID: 107527606
NCBI-ProteinID: XP_016055869
LinkDB
Position
Unknown
AA seq 314 aa
MENISEVTEFILAGLTDALEMQIPLSIVFSLIYLATLAGNLGMIVLILLDSRLHTPMYFF
LSNLSLVDCVYASAVTPKVIVGFVTGDKIISYNACAAQMFFFAAFATIESFLLASMAFDR
CVAVCKPLRYSTTMTSPVCALLVAGPYICGLLQSCIHVAFTFHLSFCHSNVVNHFFCDIP
PLLALSCSDININEIVLFTLASFNVFFTLLLILDSYLFIFIEILRMHSTEGQKKAFSTCV
SHMTTVSIFYGTIIFMYLQPSSSHSMDTDKVASVFYTMVIPMLNPLVYSLRNKEVKSAFG
KVVGKAKTLLGLAY
NT seq 945 nt   +upstreamnt  +downstreamnt
atggagaacatttcagaggtgaccgagttcattcttgcggggttgacagatgccctagag
atgcagatcccgctctccatagtcttctctctcatctacctcgccactctggctggaaac
ctggggatgatcgtgttgattctgttggactctcgactccacactcccatgtactttttt
ctcagtaacctctccctcgtggactgtgtttatgcctcagccgtcactcccaaggtaatc
gtggggttcgtcacaggagataagatcatatcatacaatgcatgtgctgcccagatgttc
ttcttcgcagcttttgccaccattgaaagtttcctcctggcctccatggcctttgatcgc
tgcgtagcagtgtgtaagcccctgcgttatagcaccaccatgacaagtcctgtgtgtgcc
ttactggtcgctggaccctacatctgtggactcttgcaatcttgcatccatgttgccttc
actttccacctctccttctgtcattccaatgttgttaatcactttttctgtgacattccc
ccactgctggctctctcttgctctgatatcaacataaatgagattgtgctcttcacattg
gcatcgttcaatgtctttttcactctcttgcttatcttggactcttacctgttcattttt
attgaaatactgaggatgcactcaactgaggggcagaagaaagccttttccacctgtgtg
tcccacatgaccactgtttccattttctatgggacaatcatcttcatgtacttacagcca
agttccagtcattccatggacacagacaaggtagcctccgtgttctacaccatggtcatc
cccatgctgaaccctctggtctacagcctgaggaacaaagaggtcaagagtgcattcggg
aaggtggttggaaaagcaaagactttgttgggcttagcctactaa

KEGG   Miniopterus natalensis: 107527607
Entry
107527607         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 10W1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527607
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527607
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527607
NCBI-ProteinID: XP_016055870
LinkDB
Position
Unknown
AA seq 337 aa
MPGGNGSVWVEFVFLAYPCRPELRALSFLGVGLLYALTVGGHVLVVAAIQADARLHTPMY
CLLGSLSGVEVCYTATVVPHMLANLLQPQKTISLPSCATQMAFFIGLGSADCFLLVVMAY
DRYVAICHPLRYPLIMTLTLCVRLVVASTLIGLVLSSQLVAFIFSLPFCQARGIEHFFCD
VPPVMRLVCANSHSHERSVLAAATLAIAVPFCVIATSYGFIVAAVAKLRSAGGRRRAFST
CCSHLAVVLLQYGCCALTYLRPDSGCSPGQGQLISLVYTLGTPLLNPLIYTLRNSEVKGA
IGRVLPRSCLRQGRARPIGKGLAPPHANPGAPKIPLG
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcccggggggaacggctcggtgtgggtggagttcgtgttcctggcctacccctgccgc
cccgagctgcgggccctgtccttcctgggcgtgggcctgctctacgcgctgaccgtcggg
gggcatgtcctcgtggtggcggccatccaggccgacgcccgcctgcacacgcccatgtac
tgtctcctgggcagcctctcgggcgtggaagtgtgctacacggcgaccgtggtgccccac
atgctggccaacctcctgcagccacagaagaccatctccctcccgagctgcgccacccag
atggctttcttcatcgggctgggcagcgccgactgcttcctcctggtcgtgatggcctac
gaccggtacgttgccatctgccaccccttgcggtaccctctcatcatgactttaactctt
tgtgttcgcctggtcgttgcttccacgctcatcggcttggtcctgtcttcacagctggtg
gccttcatcttctctctgcccttctgccaggctcggggcatcgagcacttcttctgtgat
gtgccacccgtgatgcgcctcgtctgcgccaacagccacagccacgagcggtcggtgctg
gcggcggccacactggccatcgccgtgcctttctgcgtcatcgccacgtcctacggcttc
atcgtggcggccgtggccaagctgcgctcggcaggtggccgccgccgggccttctccacc
tgctgctcccacctggccgtggtcctgctgcagtacggctgctgcgccctcacctacctg
cgccccgactccggctgctcccccgggcagggccagctcatctcgctggtgtacacactg
ggaaccccgctgctcaacccgctcatctacaccctgaggaacagcgaggtgaagggggcc
atcggaagagttctccccaggagctgtctccgccaggggagggcacggcccatcgggaag
ggtttggccccaccccacgcgaatcccggggcacctaagattccgctcggttga

KEGG   Miniopterus natalensis: 107527608
Entry
107527608         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 8U9-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527608
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527608
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107527608
NCBI-ProteinID: XP_016055871
LinkDB
Position
Unknown
AA seq 286 aa
MSNSVENCTQVTWFLLLGLTEQEGLKGTLFVLFLTVYLVTLVGNLGMIILIHTEPQLHTP
MYFFLSVLAFMDSSFSTVDTPKLLENFLTSSQSISFVGCVVQMALMTLHGIAECLLLAIM
AYDRFVAICHPLLYHTIMSQRLCVQLVAATYTASVANSVLLTGYIFKLPYCGPNVINHYF
CDIPPVLQLAVSYAYILVTICRMHSPEAQSKALATCTSHLIIICLWYGTIIFMYAQPSSL
SSTEQNKFVSVFYTVAIPVLNPLIYSLRNKDVKSALKRRYLGKLPS
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagcaactcagttgagaactgcacccaggtcacctggttcctcctgctggggcttacg
gagcaggaagggctcaagggcaccctcttcgttctcttcctcaccgtctacttagtcacc
ctcgtgggcaacctgggcatgattatcctgatccacacagagccacagctccacacgccc
atgtacttcttcctgagtgtcctcgccttcatggactcctctttctccacggtggacacc
cccaagctgctggagaacttcctcacctccagccagtccatctcttttgtcggctgtgtg
gtccagatggccctcatgactctccatggcattgctgagtgtctgctcctggccatcatg
gcctatgaccgatttgtcgccatctgccaccccctcctctaccacaccatcatgtcccaa
cgtctgtgtgtccagctcgtggcagccacctatacagcttctgttgccaattcagttttg
ctaacagggtacatctttaagctgccctactgtgggcccaacgtcattaaccactatttc
tgtgacatccccccagtgcttcaacttgcggtctcctatgcctacatcctggtgactatc
tgcaggatgcactccccggaggctcagagcaaagcgctcgccacctgcacctcccacctc
atcatcatctgcctttggtatggcaccatcattttcatgtatgctcagccgagctctctc
agttccacggaacagaacaagttcgtgtctgtcttctacactgtggccatccccgtgctg
aaccctctgatctacagcctgaggaacaaggatgtgaagtctgctttaaagaggagatac
cttggcaagctgccttcttaa

KEGG   Miniopterus natalensis: 107527609
Entry
107527609         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 1020-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527609
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527609
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527609
NCBI-ProteinID: XP_016055872
LinkDB
Position
Unknown
AA seq 319 aa
MTPGELALASGNHTPVTRFILLGFSSYPDLQELLFGAFLLIYAMTVVGNLGMLALILTDP
RLHSPMYFFLSVLSFLDICYSSVVTPKLLVNFLASDKSISFEGCVAQLTFFVAHVTAESF
LLASMAYGRFTAIRRPLHYSAVMTKGTCLRLVAASYALGGANSALQAGDVFVLPFCGPNQ
VAHFFCDIPPPLRLACANTATVRVVQRVVSALVTLVPAAVIVASYGWVLVAIGKMRSAAG
RDKALSTCASHFLAIAIFYGTVVFTYVHPRGFASDISGQVVSVSYTIIIPMLNPFICSLR
TKEVKGALQRQLRARTCPC
NT seq 960 nt   +upstreamnt  +downstreamnt
atgacacctggagaactagcccttgccagtggcaaccacaccccggtgacccggttcatc
ctgctgggcttctctagttacccagacctccaggagctgcttttcggggccttcctgctc
atctacgccatgacggtggtgggcaacctgggcatgctggcgctcatcctcacagaccct
cgtctccacagccccatgtatttcttcctcagtgtcctctcttttctcgatatttgttac
tcctctgtggtcacgcccaagctgttggtcaactttctggcctccgataagtccatctct
tttgagggctgcgtggcccagctgaccttcttcgtggcccatgtcacagccgagagcttc
ctgctagcctccatggcctacggccgcttcacggccatccgccgacccctccattacagc
gctgtcatgaccaaggggacctgtctccgcctggtggctgcttcttatgcactgggtgga
gcgaactccgctctccaggctggggatgtctttgtcctgcctttctgtgggcccaaccag
gtggcacactttttctgtgacatcccaccccctctccgcctggcgtgtgccaacacggcc
accgtgagagtggtccaacgcgtcgtctctgctctagttacgctcgtgcccgctgcagtc
atcgtcgcctcctacggctgggtcttggtggccatcgggaagatgcgctcggcagctggg
agggacaaggccctctccacgtgtgcctcccacttcctggccattgccattttctatggc
accgtggttttcacgtacgttcatcctcgtggattcgctagtgacatcagtggccaagta
gtgtccgtctcctacaccatcatcatccccatgctcaaccccttcatctgcagcctccga
accaaggaggtgaagggcgccctgcagaggcagctccgggcccgcacctgcccctgctga

KEGG   Miniopterus natalensis: 107527613
Entry
107527613         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5AK2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527613
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527613
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527613
NCBI-ProteinID: XP_016055877
LinkDB
Position
Unknown
AA seq 323 aa
MMNNAAMNILSLLVMEQNNSTQVTDFILLGFAGQDKSWHILFTVFLVIYVTTLVGNTGMI
LLIKTDSSLHTPMYFFLQHLAFVDLCYSSAITPKMLQNFVEREKSISFRGCMVQLLVYGA
FATSDSYILAAMAVDRYVAICTPLHYPTVMTQRVCIQLLVGSYLLGFLNASVNTSLTFSL
NFCKSNKINHFFCDEPPVLALSCSSIDLNIMLLTVFVGFNLTFAVSVVICSYVFILAAIL
KLSSAAGRRKAFSTCASHLTAVTIFYGTLSYMYLHHGTNKSQEQEKMASVFYSIMIPMLN
PLIYSLRNQDVKEALKGIGKKYF
NT seq 972 nt   +upstreamnt  +downstreamnt
atgatgaacaatgctgccatgaacattctttctttgttagtcatggaacaaaacaatagc
actcaggtgactgacttcattctcctgggatttgctggtcaggacaagtcttggcatatc
ctctttacggtatttcttgtgatctatgtgaccaccctcgtgggtaatacgggcatgatc
ctactcatcaagacggattccagccttcacacccctatgtactttttccttcaacacttg
gcctttgttgatctctgctacagctctgctatcactcccaagatgctgcaaaactttgta
gaaagagaaaaatccatctcattcagaggatgcatggtgcaattactagtctatggtgct
tttgccacaagcgacagctacatccttgctgcgatggcagtggaccgttacgtggccatc
tgcaccccactccactatccaacggtcatgacccagagagtctgcattcaactcttagtt
ggctcctacctcctgggtttcctaaatgcctctgtaaatacaagtcttacgttctcactc
aacttttgcaaatccaataaaattaaccactttttctgtgatgaacccccagttcttgcc
ctctcgtgctccagcattgatttaaacatcatgctcctaaccgtctttgtggggttcaac
ttgacattcgccgtgtcggtcgtcatctgttcctacgtattcatcctggctgccatcctg
aagctatcttctgctgcaggaagaaggaaagccttctccacctgtgcctcccacctgaca
gcggtcactatcttttatgggaccctctcgtacatgtatctgcaccacgggaccaacaag
tctcaagagcaagaaaaaatggcttctgtgttttacagcattatgatccccatgttaaac
ccgctcatctacagcctgagaaaccaagacgtgaaggaagctctgaaagggattgggaag
aagtacttttag

KEGG   Miniopterus natalensis: 107527614
Entry
107527614         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5AK2
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527614
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527614
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527614
NCBI-ProteinID: XP_016055878
LinkDB
Position
Unknown
AA seq 334 aa
MRAMTLMLLLTVFSPAPVHCLFSVTMTQGNSSEVTEFFLLGLSAQYKFPYALFVVFLVIY
VTSMVGNIGMILLIKTDSRLQTSMYFFLQHLAFVDICYTSSITPKMLQNFIVGDRSISFR
GCVMQLLVYAIFATSDCYLLAAMAVDRYVAICKPLHYSVVMSQRVCVHLVAGSYIMGSLN
ASVHTGFTFSLSFCKSNTINHFFCDVPPILALSCSNTDINVMLLAVFVGFNLMATVLVVI
FSYISIVVAILKMSSTTGRKKAFSTCASHLTIVTIFYTTLSYMYLQPHSSNFQENMKLAS
ICYGIMIPMLNPLIYSFRNKEVKEALKVVGERFF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgagggccatgaccctgatgctgttactcactgttttctcaccagccccagtccattgc
ttgttttcggtaaccatgacacaaggaaatagctctgaagtgactgaattctttcttcta
ggactcagtgcccaatacaagtttccatacgccctcttcgttgtatttctagtcatctat
gtgacctctatggtgggtaatatcgggatgattctgctcatcaagacagattccagactt
caaacatccatgtacttcttcttacaacacttggcttttgttgatatctgctatacctcc
tctatcactcccaagatgctgcaaaacttcatagttggagacagatcgatatccttcagg
ggctgtgttatgcaattattggtttatgcgatatttgcgaccagtgactgttacctcctg
gctgctatggcggtggaccgttacgtggccatctgcaaaccacttcactattccgttgtc
atgtcccaaagagtctgcgtccacttggtagctggttcatacatcatgggctccctaaat
gcttctgtgcacacaggttttacattttccctgtccttctgcaaatctaataccatcaat
cactttttctgtgatgttccaccaattctcgccctttcttgctccaacactgacatcaat
gttatgctacttgctgtctttgtgggatttaacttgatggccactgtgctggtcgtcatc
ttttcctacatctcgatcgtggttgccatcctgaagatgtcttcaaccacggggaggaaa
aaagccttctccacctgtgcctcccacctgacaatagtcaccattttctatacaacctta
tcgtacatgtacctacagcctcattctagcaatttccaggagaatatgaaactagcttcc
atatgttatggaatcatgatccccatgttgaaccccctgatctacagtttcagaaataag
gaagtgaaggaagctctaaaagtggtaggggaaaggttcttctag

KEGG   Miniopterus natalensis: 107527616
Entry
107527616         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5G3-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527616
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527616
SSDB
Motif
Pfam: 7tm_4 7tm_1 YbhQ Pam17
Other DBs
NCBI-GeneID: 107527616
NCBI-ProteinID: XP_016055880
LinkDB
Position
Unknown
AA seq 316 aa
MEDKNQTAVTEFLFLGLTDHLHQQIVLFATLLFIYLVTLGGNLGMITLIWIDSRLHTPMY
FFLSHLSFVDTCSSSSIAPKMLGDIFAEKRGISFMGCAAQMWCSGLFVGTECFLLASMAY
DRYMAICKPLFYTLIMSQRVCVQLVAGPYAMALISTMTHTVLTFCLPFCGPNVINHFFCD
ISPLLSLACADTWTNKLVLLILAGAIGVLSGLVITVGLVITVSYVCILVAILKIQTADGR
WKAFSTCSSHLAAVSILYGTLFFIYVLPDSGSSFDINKVISLFYTVVIPMLNPLIYSLRN
KEVKNAFRSKFERKMQ
NT seq 951 nt   +upstreamnt  +downstreamnt
atggaagacaagaatcagacggcagtgactgaatttctcttcttgggcctcacggatcat
ctccatcagcagattgtcctctttgccacgcttctcttcatctatcttgtcacactgggg
ggaaacttggggatgatcactctcatatggatcgattcccgactccatacccccatgtac
ttttttctcagtcacttgtcctttgtagatacttgttcctcttcttccattgcccccaag
atgctgggtgatatcttcgcagagaagagaggcatctctttcatgggttgtgctgctcag
atgtggtgctctggtctttttgtgggaaccgaatgtttcctcctggcttccatggcctat
gacaggtatatggccatctgtaagcccctgttctacacactcattatgtcccagagggtc
tgtgtgcagctggtggcagggccctatgccatggctcttataagcaccatgactcataca
gttctcaccttttgcttacctttctgtggtccaaatgttatcaaccacttcttctgtgac
atttcaccgctgctgtccctggcatgtgcagacacctggaccaacaagttagtgctgctc
atcttggctggagctataggggtactcagtgggctggtcatcacggttgggctggtcatc
acggtgtcctacgtgtgcatcctggtggccatcctgaagatccagactgctgatgggagg
tggaaggcgttctctacgtgttcttctcacctggcagctgtctccatcctctatggaact
cttttttttatctatgttctccctgactcaggttcctcctttgatatcaataaagtgatt
tctctgttttatactgtggtcatccccatgctgaaccccctcatctacagtctgagaaac
aaggaggtgaaaaatgcattcaggagcaagtttgaaagaaaaatgcagtaa

KEGG   Miniopterus natalensis: 107527617
Entry
107527617         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5G3-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527617
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527617
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527617
NCBI-ProteinID: XP_016055881
LinkDB
Position
Unknown
AA seq 310 aa
MDDKNQTAVTEFHFVGLTDHFPDKMILFLIFLFVYLVTLGANLGMVALIWTDSRLHTPMY
FFLSHLSLVDVGSSSSIAPKMLWDIFLERKVISVMGCAAQMWFIGQFAVTECFLLAAMAY
DRYIAICNPLLYTVIMSQRVCVQLVAGPYAMGILNAITQETFTFCLPFCGPNVVNHFFCD
ILPVLSLACANTQNNRLVLFIMAGAIVLFSGLIIMVSYVCILVAILKIHTADGRRKAFST
CSSHLAAVSILYGTLFYIYVLPGSGSSLDINKVISLFYTVVIPMLNPLIYSLRNKEVKNA
FRSKFERKMQ
NT seq 933 nt   +upstreamnt  +downstreamnt
atggatgataagaaccagacagcagtgactgagtttcattttgtgggcttaacagatcat
tttccagacaagatgattctcttcttgatctttctgtttgtgtatcttgtcacattgggg
gcgaacttggggatggttgccctgatctggacagattcccggctccacacccccatgtac
ttttttctcagccacttgtcccttgtggatgttgggtcctcttcttccattgctccaaag
atgttgtgggacatctttctggagagaaaagtcatctccgtcatgggttgtgctgctcag
atgtggtttattggtcagtttgcagtgactgagtgtttcctcctggctgccatggcgtac
gatcgatacatagccatctgcaaccctttgttgtacacagtcatcatgtcccagagggtg
tgtgtgcagctggtggcagggccttatgccatgggcatcctaaatgccattactcaagag
accttcacgttttgcttacccttctgtggtccaaatgtggtgaaccactttttctgtgac
attctccctgttctctccctggcctgtgccaacacccagaacaataggttggttcttttc
atcatggctggagccatcgtattgttcagtgggctgatcatcatggtgtcctatgtgtgc
atcctggtggccatcctgaagatccatactgctgatgggaggaggaaggcgttctccacg
tgttcttctcacctggcagctgtctccatcctctatggaactcttttctatatctatgtt
ctgcctggctcaggttcctccttagatatcaataaagtgatttctctgttttatactgtg
gtcatccccatgctgaaccccctcatctacagtctgagaaacaaggaggtgaaaaatgca
ttcaggagcaagtttgaaagaaaaatgcagtaa

KEGG   Miniopterus natalensis: 107527618
Entry
107527618         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5G3-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527618
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527618
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527618
NCBI-ProteinID: XP_016055883
LinkDB
Position
Unknown
AA seq 310 aa
MDDKNQTAVTEFHFVGLTDHFPDKMILFLIFLFVYLVTLGANLGMVALIWTDSRLHTPMY
FFLSHLSLVDVCCSSSVAPKMLWDTFPERKVISFMGCAIQMWFFGQLVVTECFLLAAMAY
DRYIAICNPLLYTVIMSQRVCVQLVAGPYAMGILNAITQETFTFCLPFCGPNVVNHFFCD
ILPVLSLACANTQNNRLVLFIMAGAIVFFSGLIITVSYVCILVAILKIHTADGRRKAFST
CSSHLTAICIFYGALFFSYVLPGSGSFLDTNKVISLFYTVVIPMLNPLIYSLRNKEVKNA
FRSKFERKMQ
NT seq 933 nt   +upstreamnt  +downstreamnt
atggatgataagaaccagacagcagtgactgagtttcattttgtgggcttaacagatcat
tttccagacaagatgattctcttcttgatctttctgtttgtgtatcttgtcacattgggg
gcgaacttggggatggttgccctgatctggacagattcccggctccacacccccatgtac
ttttttctcagccacttgtcccttgtggatgtctgctgctcttcttctgttgctccaaag
atgttgtgggacactttcccagaaaggaaagtcatctccttcatgggttgtgccatacag
atgtggttttttggtcagcttgtagtgactgagtgtttcctcctggctgccatggcgtac
gatcgatacatagccatctgcaaccctttgttgtacacagtcatcatgtcccagcgggtc
tgtgtgcagctggtggcagggccttatgccatgggcatcctaaatgccattactcaagag
accttcacgttttgcttacccttctgtggtccaaatgtggtgaaccactttttctgtgac
attctccctgttctctccctggcctgtgccaacacccagaacaataggttggttcttttc
atcatggcaggagctattgtgtttttcagtgggctaatcatcacggtgtcctatgtgtgc
atcctggtggccatcctgaagatccatactgctgatgggaggaggaaggctttctccacg
tgttcttctcacctgacagccatctgcatcttctatggggctcttttctttagctatgtt
ctgcctggctcaggttccttcttagataccaataaagtgatttctctgttttatactgtg
gtcatccccatgctgaaccccctcatctacagtctgagaaacaaggaggtgaaaaatgca
ttcaggagcaagtttgaaagaaaaatgcagtaa

KEGG   Miniopterus natalensis: 107527619
Entry
107527619         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 1002-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527619
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527619
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527619
NCBI-ProteinID: XP_016055884
LinkDB
Position
Unknown
AA seq 314 aa
MNAENQTLVIEFFFMGLTNHFQHQVVLFVIFLLVYLVTFLGNLGMITLIRIDSRLHTPMY
FFLSHLSFVDVCSSSVIGPKMLTDIFVEKKVISFLGCAAQLWFFGQFVVTECFLLAAMAY
DRYMAICKPLLYTLIMSQRVCVQLVVGPYTLGLISAVTHTTFTFRLPYCGPQIINHFFCD
LLPVLSLACANTQVNKFLLFILAGALGVLSGLIILVSYIYIIVAILKIRSADGRRKAFST
CSSHLTAVSILYGTLFFIYVRPSSGFSLDINKVVSVFYTAVIPMLNPLIYSLRNKEVKDA
FRRTVERKKFLMSR
NT seq 945 nt   +upstreamnt  +downstreamnt
atgaatgctgaaaatcaaactctggtgatcgaattttttttcatgggcttaacgaatcat
ttccagcaccaggttgtcctctttgtgatatttctcttggtttaccttgtcacttttctg
ggaaacttggggatgatcaccctcattcggatcgattcccgactccacacccccatgtac
ttttttcttagtcacctgtcctttgtggatgtgtgctcctcttctgtcattggtcccaag
atgttgactgacatctttgtggagaaaaaagtcatctctttcttaggttgtgctgcccag
ttatggttttttggtcagtttgtagtgaccgagtgtttcctcctggctgccatggcgtat
gatcgatatatggctatttgtaagcctttgttgtacacactcattatgtcccagcgggtc
tgtgtgcagctggtggtagggccctataccttgggccttataagtgccgtgacccatacg
accttcacctttcgcctgccttattgtggtccccaaatcatcaatcactttttctgtgac
ctccttccagtgctttccctggcatgtgcaaacacccaggtcaacaaatttttgctattc
atcttggctggagccctaggagtcctcagtggcctgatcatcttggtctcctacatttac
atcatcgtcgccatcctgaagatccgctctgccgatgggagacgcaaagccttctccacc
tgctcctctcacctgacagccgtgtccatcctgtacggtactctcttctttatctacgta
cgtccgagttctggtttctccctggacatcaataaagtggtgtctgtgttttatacagct
gtaattcccatgttaaacccacttatctacagcctgagaaacaaggaagtcaaggatgca
ttcagaaggacagttgaaaggaagaagttcctgatgagcaggtaa

KEGG   Miniopterus natalensis: 107527620
Entry
107527620         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 1009-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527620
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527620
SSDB
Motif
Pfam: 7tm_4 7tm_1 ECSCR
Other DBs
NCBI-GeneID: 107527620
NCBI-ProteinID: XP_016055885
LinkDB
Position
Unknown
AA seq 313 aa
MANENYTRVTEFIFTGLNYNPQLQVFLFLLFLSFYIVNLTGNLGMIILIRINSHLHTPMY
FFLSHLSFVDICFSSVVSPKMLNDFFVKRKVISFLGCALQQWFFGFFVAVECFLLASMAY
DRYVAIRNPLLYFIAMSQGLCIQLVVGPYVIGFMNTMTHTTNTFRLPFCGPNVINHFFCD
VFPLFSLVCADTELTKLVVFVVAGAVGVLSGLIILVSYVYIIVAILKIRSAHGRRKAFST
CSSHLTAVSILYGTLFSIYVQPSASFSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKDA
IHRAVAKGKTCWA
NT seq 942 nt   +upstreamnt  +downstreamnt
atggccaatgaaaactacacaagggtcaccgaattcattttcacgggtttgaattacaac
ccccagctgcaggtctttctctttttgctctttctgagcttctacatcgtcaacctaaca
ggaaacttgggtatgatcattctgatacggatcaattcccaccttcacacacctatgtac
ttttttctgagccacttgtcctttgtggacatctgcttctcctcggtagtgagccccaag
atgctcaatgacttctttgtgaagaggaaagtcatctctttcttgggctgtgctctgcag
cagtggttctttgggttcttcgtggcagtagagtgtttcctcttggcgtccatggcctat
gaccgctacgtagccatccgcaacccattattgtacttcattgccatgtcccagggactc
tgtatccagctggtggttggcccctatgtcatcgggttcatgaacaccatgactcacaca
acaaacacatttcgtctccctttttgtggccccaatgtcatcaatcatttcttctgtgat
gtgttccccctgttttcacttgtatgtgcggacaccgagctcactaagttggtagtcttt
gtcgtggcaggagctgtgggggtcctcagtggcctgatcatcttggtctcctacgtttac
atcatcgtcgccatcctgaagatccgctctgcccatgggaggcgcaaagccttctccacc
tgctcctctcacctgacagccgtgtccatcctgtacggtactcttttctctatttatgta
caacctagtgcaagcttctccctggatctcaataaagtggtgtcagtgttttacacagca
gtgatccccatgttgaacccgcttatctacagtttgaggaacaaggaagtgaaagacgcc
atccacagggctgttgccaaggggaagacttgttgggcctga

KEGG   Miniopterus natalensis: 107527622
Entry
107527622         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 9G4
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527622
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527622
SSDB
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Other DBs
NCBI-GeneID: 107527622
NCBI-ProteinID: XP_016055886
LinkDB
Position
Unknown
AA seq 312 aa
MKVGNFTILTEFVLVGLSANPQWQPILFVLFLILYLITLSGNVTLVILIRIDSRLHTPMY
FFIGNLSFLDFWYTSVYTPQILASCVSEDKRISLAGCGAQLFFSCVVAYTECYLLAAMAY
DRHMAICNPLLYSSAMSSSLCAGLVAASYIGGFLNAIAHTANTFRLSFCGKNIIDHFFCD
APPLVKMSCTDTQVYEKVLLGVVGFTVLSSILTILISYFNILLAILRIRSASGRRKAFST
CASHLLSVMFFYGSLLFMYSRPSSTYSLEKDKVAALFYTVVNPLLNPIIYSLRNKDVKEA
FWKATRTIRPQR
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaaagtggggaacttcaccatcctgactgagttcgtcttggtgggcttgtcggcaaac
ccccagtggcagccaattctatttgtactgtttctgatcctctacttaataaccttgtca
gggaacgtgaccctggttatcttaattcgtattgattcccgcctgcacacacctatgtac
ttcttcattggcaatctgtcttttttggatttttggtacacctctgtgtacactccccaa
atcctggccagttgtgtctcggaggataaacgcatttccttggctgggtgtggagcccag
ctgttcttctcctgtgttgtagcctacacggagtgctatctcctggccgccatggcgtat
gaccgccacatggccatctgtaacccattactttattccagcgccatgtccagctccctg
tgtgctggactggttgctgcctcctacataggaggattcttaaacgccatagcccacact
gccaacactttccgcctgagtttttgtggtaaaaatatcattgaccacttcttctgtgat
gcaccaccattggtaaaaatgtcttgtacagacacccaggtctacgaaaaagtcctcctg
ggtgtggtgggcttcacagtcctctccagcattctcaccatcctgatttcctatttcaac
atccttcttgctattctgaggatccgctcggcctctgggcggcgcaaggccttctccacc
tgcgcttcgcacctcctctcggtcatgttcttctatggatccttgctcttcatgtattca
aggccaagctccacctactctctggagaaagacaaagtggctgccctgttctacactgtg
gtcaacccattgctcaaccctatcatctatagcctgagaaacaaagatgtcaaagaggcc
ttctggaaagcaacacggaccataaggccacagagatga

KEGG   Miniopterus natalensis: 107527623
Entry
107527623         CDS       T05883                                 

Definition
(RefSeq) putative olfactory receptor 2B8
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527623
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527623
SSDB
Motif
Pfam: 7tm_4 7tm_1 UPF0542
Other DBs
NCBI-GeneID: 107527623
NCBI-ProteinID: XP_016055887
LinkDB
Position
Unknown
AA seq 314 aa
MDTKKTNLTVTEFVFLGLSSEPKVQLILSVMFLSFYLITVAGNVLLITLTQLDPRLQSPM
YFFLTNLAFLDVCYTSTNVPQMLSNMLGKKKTIPFSSCAAQMYFSLSFGMIECVLLGVMA
YDRYVAICQPLHYTVIMDRNTCVQLAAVSWSSSFLSSMIINVLTLSLPYCGPNVLNHFFC
EVPSVLRLACTDTSLTEMVVFIFSVVIVFTPFLLIVVSYARILLSVLRMRSASGRRKALS
TCAAHLTVVALFYGTAIFMYMRPQPKSSRAGGKIIAVFYTVITPMLNPLIYSLRNQDVKG
ALRRAIVRQKAGGL
NT seq 945 nt   +upstreamnt  +downstreamnt
atggatacaaaaaaaacaaacctcaccgtgactgaatttgtgttcctggggctctcatca
gagcccaaggtgcagctcattctttctgtcatgttcttgtccttctatttaataacggtg
gctggaaatgtccttctcatcactcttacccagctggaccctcgtctccaaagccccatg
tacttcttcctcactaacttggcctttctggatgtctgctacacgtccaccaacgtcccg
caaatgctgtccaacatgctggggaaaaagaagaccatccccttctccagctgcgctgcc
cagatgtacttctccctctccttcggcatgattgaatgcgtcctcctgggtgtcatggct
tatgacagatacgtagccatttgtcaacctcttcattacactgtcattatggatcgaaac
acctgtgtccaactggcggccgtttcttggtccagtagcttcctgagctccatgattatc
aacgtcctcactttgagtttgccctactgtgggcccaatgtcttgaatcactttttctgt
gaggtgccctctgtcctgaggttggcttgcacggacacctcgctcactgagatggttgtt
ttcatcttcagtgtcgtcattgtcttcactccttttctcctcattgttgtttcctatgcc
cggatcctcctgtcggttctcaggatgcgctcggcctcggggaggcgcaaggcgctgtcc
acctgtgccgcccacctcaccgtggtggccttgttctatggaactgccatcttcatgtac
atgaggccccagccgaagtcctccagggccgggggtaagatcattgcggtgttctacacc
gtgatcacacccatgctcaaccccctgatctatagcctaaggaaccaggatgtgaaagga
gctttaaggagagctatcgtaagacaaaaggcaggggggctctga

KEGG   Miniopterus natalensis: 107527624
Entry
107527624         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 1020-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527624
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527624
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527624
NCBI-ProteinID: XP_016055889
LinkDB
Position
Unknown
AA seq 312 aa
MSNHSTVTEFILLGFSNHPELQCLLFMVFLVAYIVTVFGNLGMILLIKINSRLHTPMYFF
LSNLSLVDFCYSSVIAPKMLVNFWVESPVISFNECAAQFFFFGSFAGIEGFLLAVMAYDR
YVAICKPLLYTATMSPHLNVLLVLATYLAGFVNASIHTGFTFQLSFCHSNVINHFFCDTP
PLLKLSCSDTRVNEVVIFAFASLNELSCLLAILVSYLHILVAILRIRSAEGRHRAFSTCA
SHLMAVTIFFGTILFMYLRPSSSYSMDQDKVVSVFYTLVIPMLNPLIYSLRNKEVKASLG
NIFKTPSFCFCA
NT seq 939 nt   +upstreamnt  +downstreamnt
atgagcaaccactcaacagtgactgaatttattctgctgggattcagcaaccatccagag
ctacagtgccttctcttcatggtgtttctagtcgcctatatcgtcacagtgtttggaaat
cttggcatgatcctattaatcaagataaactcacggctccacaccccgatgtactttttt
ctcagtaacttgtcccttgtggacttctgttattcttctgtcattgcccctaagatgctg
gtgaatttctgggtggagagccccgtcatttcgtttaatgaatgtgccgcgcagttcttc
ttttttggttcctttgctggcatcgaaggcttcctgctggctgtgatggcctatgaccgg
tacgtggccatctgcaagcctctcctttacacagccacgatgtccccccatcttaatgtc
cttctggtactggccacatatcttgcaggctttgtgaatgcctccatccacactggcttc
accttccaactgtccttctgccactcaaatgtcatcaaccactttttctgtgacactcca
cccctcctgaagctctcttgttccgacacgcgtgtcaatgaggtggtcatttttgctttt
gccagtttgaatgaactgagctgccttctggccattctcgtctcctatctccacatccta
gttgccatcttgaggatccgttcggccgaggggaggcacagggccttctccacctgcgcg
tcccacctgatggctgtcaccatcttctttggcaccatcctgttcatgtatctgcgcccc
agctccagctactcaatggatcaggacaaagtggtgtctgtgttttatacgttggtcatt
cccatgttaaatcctctcatctacagtctgaggaacaaagaggtcaaagcttctttaggc
aacatttttaaaacaccctctttttgcttctgtgcttag

KEGG   Miniopterus natalensis: 107527626
Entry
107527626         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5M10-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527626
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527626
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527626
NCBI-ProteinID: XP_016055890
LinkDB
Position
Unknown
AA seq 329 aa
MSSPNHTTVTEFILLGLTDDPALEKILFGVFLVIYLITLAGNLGMIVLIRTSPHLQTPMY
FFLSHLSFVDICYSSNVTPNMLHSLLSGHKAVSHAGCFSQCLLFIALVITEFYLLASMAL
DRHAAICSPLHYSTRMAKDICVSLVALSYAFGFLNGLSQALLTFRLSFCGSREINHFYCA
DPPLIMLACSDAHVKKVAMLAVAGFTLSSSLLLILLSYLSILAAVLRIRSAQGRRKAFST
CGSHLTTVTIFYGTLFCMYLKDPSERFIEESKVLAVFYTFLSPMLNPLVYSLRNKHVIHA
MQQLVKGNLSHKNAVEASVDLKLAVSVIK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtcttccccaaaccacacgacggtgacagaattcattctcttgggactcacggacgac
ccagcactagagaagatcctgttcggggtgtttctggtgatctacctaataacactggca
gggaatctgggcatgatcgtgctgatcaggaccagcccccacctccaaactcccatgtac
ttcttccttagccatctctcctttgtcgacatttgctactcctccaacgtcaccccaaat
atgctgcacagtttgctgtcgggccacaaggccgtctcccacgctgggtgcttctcgcag
tgcctcctcttcatcgcgctggtgatcactgagttttacctcctcgcttccatggccctg
gatcgccacgcagccatctgcagcccgttgcactacagcaccaggatggccaaggacatt
tgcgtctctctggtcgccctctcttacgcttttggcttcctcaatggactgtctcaggcg
ctgctgacctttcgcttgtccttctgtggctcccgtgaaatcaatcacttctactgtgcc
gacccccctcttatcatgctcgcttgctccgacgcccacgtcaagaaggtggccatgctt
gcggtggccgggtttaccctctcgagctccctcctcctcattctcctgtcctacctttcc
attcttgcagccgtcttgaggatccgctctgcccagggcaggcgcaaagccttctctact
tgcggctcccacctgacaacggtcactatcttttatgggaccctcttctgcatgtacttg
aaggacccatccgagaggttcatcgaggagtccaaagtccttgccgtcttttatactttc
ttgagcccaatgctgaacccgttggtctacagtctgaggaacaagcatgtgatccacgcc
atgcagcaactggtcaaagggaatctctcccataaaaatgcggttgaggcatcagttgat
ttgaaattggcagtgtctgtgataaaatag

KEGG   Miniopterus natalensis: 107527627
Entry
107527627         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 1030
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527627
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527627
SSDB
Motif
Pfam: 7tm_4 7tm_1 Pep3_Vps18
Other DBs
NCBI-GeneID: 107527627
NCBI-ProteinID: XP_016055891
LinkDB
Position
Unknown
AA seq 318 aa
MLAPKKMVRGNATLVSEFILLGLTDRPELQPVLFVLFLVIYLITVGGNLGMLVLIRIDSG
LHTPMYFFLASLSCLDLCYSTNVTPKMLANFLSEKKTISYAACLAQCYFFIAMVITEYHM
LAVMAYDRYTAICSPLLYSSRMSRGVCIRLIAGPYAYGFLSGLMETLWTHRLTFCGSNVI
NHFYCADPPLIRLSCSDTFIKETSMFVVAGLNLSSSLLIIGVSYTFILAATLRIRSAQGR
QKAFSTCGAHLVAVTVFYGTLFCMYVRPPTDQSVEESKIVAVFYTFVSPMLNPIIYSLRN
KDVKRDLWKLMRRNVLLK
NT seq 957 nt   +upstreamnt  +downstreamnt
atgctggcacctaagaaaatggtccgaggaaatgccaccttggtgagcgaatttatcctt
ttaggattaacggatcgtccagagcttcagcccgtcctcttcgtgctgttcctggtgatc
tacctgatcacggttggggggaaccttggcatgctggtgctgatcaggatagattcaggc
ctccacacccctatgtacttctttcttgccagcctgtcctgcttggacttgtgctattcc
accaacgtgactcctaagatgctggccaacttcttatcagagaagaaaaccatttcctac
gcggcttgcttagcccagtgttattttttcattgccatggtcatcactgaatatcacatg
ctggctgtgatggcctatgacaggtacacggccatctgcagccctttgctttacagcagc
aggatgtccagaggcgtgtgcatccgcctgattgctggtccctatgcctatggcttcctt
agtggcctgatggagaccctgtggacacaccgcttgaccttctgcggctccaacgtcatc
aatcacttctactgcgccgacccgcccctcatccgcctctcctgctccgacacgttcatc
aaggagacatccatgtttgtggtggcggggcttaacctctccagctccctcctcatcatc
ggcgtctcctacaccttcatcctcgccgccaccctgaggatacgctctgcccagggcagg
cagaaggccttctccacctgtggggcccacctggtggcagtgaccgtgttttacgggacc
ctgttctgcatgtacgtcaggccccccacggaccagtcagtggaggagtccaaaatcgtc
gccgtgttctacacgtttgtgagccccatgttgaaccccatcatctacagcctgcggaac
aaagatgtgaagcgagatctgtggaaactgatgcgaaggaatgtgcttttgaagtaa

KEGG   Miniopterus natalensis: 107527629
Entry
107527629         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 1030-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527629
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527629
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527629
NCBI-ProteinID: XP_016055893
LinkDB
Position
Unknown
AA seq 312 aa
MSRRNYTEVTEFILLGLTSRPELQVAFFVVFLVVYIVTVIGNVGMIVLIKIDSRLHTPMY
FFLSSLSVLDLCFSTNVTPKMLENFFSEKKTISYAGCLVQCYLVIAVVLTEHCMLAVMAY
DRYVAICTPLLYGSRMSKSVCVRLVIVPYVYGSLLSVMETLRTYSLSFCGANEINHFYCA
DPPLIRLACSDTYSKELSMYIVAGYSNAQSLLIILTSYMLILVAILRSRSAEGRKRAFST
CGSHLTVVTIFYGTLLCMHLRRPTEESVEQGKVVAVFYATVIPMLNPMIYGLRNKDVKQA
LRRAMGRQKLGK
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtccagaagaaactacactgaagtgacagaatttattctcttgggcctaacaagccgc
ccagagctgcaagttgctttcttcgtggtgttccttgtggtctacatagtcactgtgata
ggcaacgtgggcatgattgtgttaatcaaaattgattctcggctccacactcccatgtac
ttctttctctcaagtctgtctgttctagatctgtgtttctccacaaatgtcactcccaaa
atgctagagaatttcttctcggaaaagaagaccatctcctatgcaggttgcttggtgcag
tgctatctggtcatcgccgtggtcctcacagagcactgcatgttggcggtcatggcatat
gaccgctacgtggctatctgcactccactgctctacggcagcaggatgtccaagagcgtc
tgtgtccgcctggtcattgtcccctacgtctatggctccctccttagtgtgatggagacc
ttgaggacctacagcctctccttctgcggcgctaatgagattaaccatttctattgtgcc
gatcctcccctcatcaggctggcgtgttctgacacctacagcaaggagctgtcgatgtac
attgtcgctggctacagcaacgcgcagtccctgctgatcatcctcacgtcctacatgctc
atccttgtcgccatccttaggagccgatctgcggaaggaaggaaaagagccttctccaca
tgtggctcccacctgactgtggtcacaatcttctacggaaccctcctctgcatgcacttg
agacgccccacagaggagtctgtggagcaggggaaagtggtggctgtgttttacgccacg
gtgatccccatgctgaaccccatgatctacggcctcaggaacaaagatgtgaaacaggca
ctgagaagagcgatggggaggcaaaaattggggaaataa

KEGG   Miniopterus natalensis: 107527630
Entry
107527630         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5M9
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527630
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527630
SSDB
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Other DBs
NCBI-GeneID: 107527630
NCBI-ProteinID: XP_016055894
LinkDB
Position
Unknown
AA seq 310 aa
MPNFTDVTEFILLGLTRHQELQVLLFVVFLVVYIFTLLGNIGMIILISVTPQLQSPMYFF
LSHLSFVDVWFSSNVTPKMLENLLSETKTISYVGCLVQCYFFIALVHVEVYILAVMAFDR
YMAICNPLLYGSKMSRAACIRLISVPYVYGFSVSLICTLWTYGLYFCGNVEINHFYCADP
PLIKIACGGVYIKEYTMIVIAGINFTYSLSVVTLSYTLIVVAVLRMPSADGRKKAFSTCG
SHLTAVTMFYGTLIFMYLRRPTEESVEQGKVVAVFYTTVIPMLNPMIYSLRNKDVKLAVS
KAISKANLGR
NT seq 933 nt   +upstreamnt  +downstreamnt
atgccaaatttcacggatgtgacagagtttattctcctggggctgacccgccaccaggag
ctccaagtcctcttgtttgtggtgttcctcgtagtttacatattcactctgctagggaac
attggtatgatcattttaatcagcgtcactccccagcttcagagccctatgtacttcttc
ttgagtcatctgtctttcgtggatgtgtggttctcttccaatgtcacccccaaaatgctg
gagaacttattatcagagacaaaaaccatttcctacgtgggatgtttggtgcagtgttac
tttttcatcgccctcgtccacgtggaggtctatatcttggccgtgatggcctttgatcgc
tacatggccatctgcaaccctttgctctatggcagtaaaatgtccagggctgcctgtatt
cggctcatttctgtgccttatgtctacggattctctgttagtctcatatgcacactatgg
acgtatggcctgtacttctgcggaaacgttgaaatcaaccacttctactgtgcagaccct
cctctcatcaagattgcctgcgggggggtctacatcaaagaatacacgatgatcgtgatt
gctgggatcaacttcacatactccctctcagtggtcaccctctcctacaccctcattgtg
gtcgctgtgctgcgcatgccctctgctgacgggaggaagaaggccttctccacatgcggg
tcccacttgacggctgtcaccatgttttatgggactctcatattcatgtatctcaggcgg
cccactgaagagtctgtggagcaggggaaagtggtggctgtgttttacaccacagtgatc
cccatgctgaaccccatgatctacagtctgagaaacaaggatgtgaaattggcagttagc
aaagcaatctccaaggccaacctggggcggtga

KEGG   Miniopterus natalensis: 107527631
Entry
107527631         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 8J1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527631
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527631
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527631
NCBI-ProteinID: XP_016055895
LinkDB
Position
Unknown
AA seq 315 aa
MAPANLSRVTEFVLAGVSGRPELRVPLFLVFLAIYGLTVTGNLSIITLTCVDSRLRTPMY
FFLQHLALINLGNSTVIAPKMLINFFVAKKSISYYECAAQLGAFLVCIVAEVSLLAAMAY
DRYVAICNPLLYLVALSRHKCLLLVSLTYVYSLSTAIVTSLSVFSVSYCSCNVIDHFYCD
TVPLLALSCSDTYLPKTVIFVSATTNLVCSMTVVLVSYFNIILSVLSLRSSEGRKKAFST
CASHLVAVTVFYGTLLFMYSQPRGNHSLDTDKMASVFYTLVIPMLNPMIYSLRSRDVRAA
SERLLTSLCCSFKSK
NT seq 948 nt   +upstreamnt  +downstreamnt
atggctcctgcgaacctctcccgggtcaccgagtttgttctcgcaggtgtctcgggccgc
ccggagctccgggtgcccctgttccttgtcttcctggccatctacgggctgacggtgaca
gggaacctcagcatcatcacgctcacctgcgtcgactcccggcttcgcacccccatgtac
tttttcctccagcacttggctctcatcaacctcggcaactcgactgtcattgcccctaag
atgctgatcaactttttcgtagcgaagaaaagcatctcctactatgaatgcgccgcccag
ctgggggcgtttttggtgtgcatcgtggctgaggtgtccctgctggccgcgatggcctac
gaccgctacgtggccatctgtaaccccctgctctacttggtggctttatctcgccacaag
tgccttctgctcgtatccctcacctacgtctatagcttgtccacggctatcgtgacgtca
ttgtctgtattctctgtgtcctactgctcttgcaatgtgatcgatcatttctactgtgac
actgtccctctgctagccttgtcctgctctgacacctacctccccaagacagtcattttt
gtatctgcaactacaaatttggtctgctccatgactgtagtgcttgtatcgtatttcaac
atcattctgtccgttttaagtctacgttcatcagaaggaaggaaaaaggccttctccacg
tgtgcttcgcacctggtggctgtcaccgttttctatgggacgctgctgttcatgtattcg
cagcctcggggcaaccattcgctggacactgataaaatggcttctgtgttttatacactg
gtgatccccatgctgaaccccatgatctacagcctcaggagtagggacgtgagggcggcc
tcggagaggttgctcacaagcctgtgctgttcctttaaatcaaaataa

KEGG   Miniopterus natalensis: 107527632
Entry
107527632         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 8K1
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527632
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527632
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527632
NCBI-ProteinID: XP_016055896
LinkDB
Position
Unknown
AA seq 316 aa
METHNHSAVTTVTEFILMGITDNPKLQAPLFGVFLVIYLVTVMGNLGTVILTHLDAKLHT
PMYFFLRHLAITDLGYSTAIGPKMLASFVVQRNTISSGCCAAQLASLEVFIIAEFFILSA
MAYDRHAAICKPLVYAVIMAQRVRWALVLAPYAYGTFVSLFLTVKLFRLPFCGPDTISYF
YCDCLPLLSLLCSDTRELELIVCIFSGCNLLSSLSVVLVSYGFILVALVRMKSPEGRRRA
FSTCSAHLTVVVVFYGTLLSIYLRPRASRAAHADQAASVFYTLVIPMLNPLIYSLRNREV
KDALKRTLTKRCRSSA
NT seq 951 nt   +upstreamnt  +downstreamnt
atggagacacacaatcatagcgcagtgaccacggtgactgaatttattctcatggggatc
accgacaaccctaagctgcaggcgcctctctttggagtgttcctggtcatatacttggtc
acagtgatgggcaacctgggcacggtcatcttgacccatttggacgccaagctgcatact
cccatgtactttttccttagacatctggcaatcacggatcttggctactccactgccatc
ggccccaaaatgctggccagctttgtggtgcagagaaacacaatttcctccggctgctgc
gcggcgcagctggcctcgctggaggttttcatcatcgccgagttcttcatcctgtcggcg
atggcctacgaccgccacgctgccatctgcaagcccctcgtctacgcggtcatcatggcc
cagagggtgcgctgggcgctggttctcgccccctatgcctacggcacgttcgtgtcgctc
tttctcactgtcaagttgtttcgcctgcccttctgtggccctgacaccatcagctacttc
tactgcgactgcctgcccctgctgtccctgctctgctccgacacgcgcgagctggagctg
atcgtgtgcatcttttcgggctgtaacctgctctcttccctctcggtggtgctcgtgtcc
tacggcttcatcctcgtggcccttgtcaggatgaagtccccggaggggaggcgcagggcc
ttctccacgtgcagcgcgcacctgacggtggtggtcgtgttctacgggaccctgctgtcc
atctacctgcggcccagggccagccgggctgcccacgccgaccaagcggcctctgtgttt
tacaccctggtgatccccatgctgaacccgttgatctacagcctgaggaacagagaagtc
aaagatgctctgaaaaggactttaactaagcgctgcagaagctctgcttaa

KEGG   Miniopterus natalensis: 107527633
Entry
107527633         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 8K5-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527633
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527633
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527633
NCBI-ProteinID: XP_016055897
LinkDB
Position
Unknown
AA seq 360 aa
MNLSCLQSAGSHGTQVKEVRLLPSGAREKARGLLLRRPATKESYLDSVGQQNLTQLSEFI
LMGVTRQPELQVPLFLVFLTIYTVTVVGNLGMILLTQVDSHLHTPMYFFIKHLALIDLGN
STVICPKMLVNFIVDQNVISYYACATQLAFFLMFIISEFFILSAMAYDRCSAICNPLLYN
VIMSQRRCHVLVGIPYLYGSFQALLFTIKIFTLTFCGSNVINHFYCDDVPLILLLCSNAQ
EIEFLIILFSAFNLLSSLLVVLVSYTLILITIFRMHSAEGRRKAFSTCGSHLTVVVIFYG
SLLFMYTQPKSAHSFDTDKIASVFYTLVIPMLNPLIYSLRNKEVKNAFHRVFKNPCKLCI
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacctcagctgcctccagagcgcggggagccacgggactcaagtaaaagaggtgcgg
ctgctgccatctggggcccgggagaaagcgagaggcctgctgctaaggaggcctgccacg
aaggagagctatctggactcagtgggccaacagaatctaacacaattgtctgaattcatt
ctgatgggagtcacaaggcagcctgagctgcaggttccacttttcctggtcttcctcacc
atctacaccgtcacagtggtaggcaacctgggcatgatccttttaacccaggtggactcc
cacctacacacacctatgtatttttttatcaaacacctggctctcattgatcttggtaat
tctactgttatttgtccgaagatgctggtaaattttattgtggatcaaaatgtcatttca
tattacgcatgtgccacccagttggctttcttccttatgtttattatcagtgaatttttc
atcttgtctgccatggcctatgaccgctgttccgccatctgtaaccctttgctctacaat
gtgattatgtcccagagacgctgtcatgtgttggtgggcatcccgtacctctacggtagc
tttcaggctcttctgttcactattaagatttttacactgaccttttgtggctctaatgtc
ataaatcatttctactgtgatgatgttcccttgatacttttgctctgctcaaatgcacaa
gaaatagaattcttgatcatactattttcagcatttaatttgctctcctccctgctggta
gttttggtatcctacactctgattctgatcaccatatttcgcatgcattctgcagagggc
aggagaaaagctttttccacatgtggttctcacctgacagtggtggttatattctatggg
tccctactatttatgtacacacagcccaaatccgctcactcctttgatactgataaaatc
gcctctgtgttctacactttagtgatccctatgcttaatcccttgatatacagcttaagg
aacaaagaggtaaaaaatgccttccatagggtttttaagaatccatgcaaactttgtatt
taa

KEGG   Miniopterus natalensis: 107527634
Entry
107527634         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 8K3-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527634
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527634
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527634
NCBI-ProteinID: XP_016055898
LinkDB
Position
Unknown
AA seq 327 aa
MDTQNLTALKEFILTGVTDQPELQATFCGVLLFVYGVSVVGNLGMVILTKVDSRLHTPMY
FFLRHLAVTDLGYSTAVGPKTLVNIVTKQKTIPYDWCAAQLAFFILFIISELFLLSAMAY
DRYVAICNPLLYTVIMSPRVCWVLVAVPYLYSAFLSLITTIKIFISSFCGHNVINHFYCD
SLPLLTLLCSSSREIELIILIFSVFNLVSSLLVVLVSYTLILLAVLRMSSAEGRHKAFST
CGSHLTVVLVLYATLFFMYVQPKSSHSFDSDKMASVFYTLIIPMLNPLIYSLRNKEVKGA
LHRVWENLCNIFVKNPVWYKWKEERKE
NT seq 984 nt   +upstreamnt  +downstreamnt
atggacacacaaaacctaacagcgctaaaagaattcattctgacgggagtcacagaccag
cctgagctgcaggccaccttctgcggggtgttgctcttcgtctacggggtctccgtggtg
ggcaacctgggcatggtcatcctcaccaaggtggactccaggctccacacgcccatgtac
ttcttcctcaggcacctggctgtcactgatcttggctattcaacagccgtgggacccaaa
acgttggtaaacattgtaactaaacaaaagactatcccctacgactggtgtgcggcccag
ctggcgttcttcatcttgttcatcatcagcgagctcttcctcctgtcggccatggcctat
gaccgctatgtggccatctgtaaccctctgctctacacggtcatcatgtcgccaagggtg
tgctgggtgctggtagcagtcccctatctctacagtgcctttctctctctgataaccacc
ataaagatttttatttcatctttctgtggccataatgtcattaatcatttctactgcgac
agtcttcccttgttgacattgctctgctcgagctcccgtgagattgagttgataatactg
atcttttcggtgtttaatctggtttcgtctctcctggtggtccttgtgtcctacacgctg
atcctcctggccgtcctcaggatgagctctgcagagggcaggcacaaggccttctccacc
tgcggctctcacctgacagtggtgcttgtgctgtatgcgacgctgttcttcatgtatgtg
cagcccaagtccagtcactccttcgacagtgataaaatggcctctgtgttttacactttg
atcatccccatgctgaatcccttgatctacagcttgagaaacaaagaagtgaaaggtgcc
ctgcatagggtatgggaaaatctatgcaatattttcgtcaagaatcctgtgtggtacaaa
tggaaggaagaaaggaaggaatag

KEGG   Miniopterus natalensis: 107527635
Entry
107527635         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5T1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527635
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527635
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 107527635
NCBI-ProteinID: XP_016055900
LinkDB
Position
Unknown
AA seq 332 aa
MKMSQSTSDLDVHRIQSKNVTEVTVFILMGFTNNFEMQVFLFLLFLEIYLFTLVGNLGMV
LLVSRDSRLHNPMYYFISVLSFLDACYSSVVTPKMLVSFLEEKKAISYVGCAAQMFLFMF
FAVAFGTTECFLLAAMAYDRYVAIYNPLLYSVSMSPRVCVSLVAASYVGGLLHASVHTAA
TFSLSFCASNEIRHVFCDIPPLLAISCSDTHTNQLLLFYFVGSIETVTILVVLVSYGFIL
LAILRVHSGDGRRKVFSTCGSHLAGVAIYHGTILFMYVRPSSSYALDHDMIVSLFYTVVI
PMLNPVIYSLRNRDVKEAMKRVLGRSGCGSKG
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaaaatgtcacagtcgacctcagacttagacgtacacaggattcagtcgaaaaatgtg
actgaggtcactgtgtttatactgatgggcttcacaaataattttgagatgcaagtcttc
ctgtttttgctatttctagaaatctatctgtttactctggtaggaaatttggggatggtt
ttgttggtcagtagggactcccggctccacaaccctatgtactattttattagtgtgtta
tcgttcttggacgcctgttattcttccgttgtcaccccaaagatgttggtcagtttcctg
gaagagaaaaaggccatttcgtacgttgggtgcgcggcacaaatgtttctctttatgttt
ttcgctgtggcttttgggaccacggaatgcttcctcctggccgcgatggcctacgatcgc
tacgtagccatctacaaccccctcctgtattcagtgagcatgtcacccagggtctgcgtg
tccctcgtcgccgcttcctatgttggtggccttttgcatgcctctgtgcacacggcggcc
acatttagcctgtccttctgcgcttccaatgaaattaggcacgtcttctgtgacatcccc
cccctccttgccatctcttgctccgacacccacaccaaccagctgctgctcttttacttc
gtgggctctattgagacggtcaccatcctggtcgtgctggtgtcctacggcttcatcctg
ctggccattctgagggtgcattccggcgacggcaggaggaaagtcttctctacgtgcggc
tcccacctcgccggagtggccatttatcacgggaccatcctcttcatgtacgtgaggccc
agctccagctacgctttggaccacgacatgatagtgtcgttgttctataccgtggtgatt
cccatgctgaaccccgtcatctacagcctgaggaacagagacgtgaaagaggcaatgaag
cgagtgctggggagaagcgggtgtgggagtaaaggatag

KEGG   Miniopterus natalensis: 107527636
Entry
107527636         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5T2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527636
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527636
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527636
NCBI-ProteinID: XP_016055901
LinkDB
Position
Unknown
AA seq 312 aa
MENVTAVTVFVLKGLTDELEQQSLLFLLFLAIYLFTLTGNLGLVLLVIGDSQLRNPMYYF
LSVLSSVDACFSSVITPNMLVDLLSKNKVISFLECATQMFFAVAFGTTECFLLAAMAYDR
YVAIYNPLLYSVSMSPRVCVSLVAASYVGGLLHASVHTAATFSLSFCASNEIRHVFCDIP
PLLAISCSDTHTNQLLLFYFVGSIETVTILVVLVSYGFILLAILRVHSGDGRRKVFSTCG
SHLAGVAIYHGTILFMYVRPSSSYALDHDMIVSLFYTVVIPMLNPVIYSLRNRDVKEAMK
RVLGRSGCVGKG
NT seq 939 nt   +upstreamnt  +downstreamnt
atggagaacgtgacggcagttactgtgtttgtactgaagggcctcacagacgagcttgaa
cagcagagcctcttatttctcctgttcctagcaatctatctgtttactctgacgggaaat
ttagggctggttctactggtcattggggactcccagctccgcaaccccatgtactatttt
ctgagtgtgttgtcatctgtggatgcctgcttttcctcggtaattacaccaaatatgtta
gtagatctcctttcaaagaataaagtcatttcattccttgagtgtgcaactcagatgttt
ttcgctgtggcttttgggaccacggaatgcttcctcctggccgcgatggcctacgatcgc
tacgtagccatctacaaccccctcctgtattcagtgagcatgtcacccagggtctgcgtg
tccctcgtcgccgcttcctatgttggtggccttttgcatgcctctgtgcacacggcggcc
acatttagcctgtccttctgcgcttccaatgaaattaggcacgtcttctgtgacatcccc
cccctccttgccatctcttgctccgacacccacaccaaccagctgctgctcttttacttc
gtgggctctattgagacggtcaccatcctggtcgtgctggtgtcctacggcttcatcctg
ctggccattctgagggtgcattccggcgacggcaggaggaaagtcttctctacgtgcggc
tcccacctcgccggagtggccatttatcacgggaccatcctcttcatgtacgtgaggccc
agctccagctacgctttggaccacgacatgatagtgtcgttgttctataccgtggtgatt
cccatgctgaaccccgtcatctacagcctgaggaacagagacgtgaaagaggcaatgaaa
cgagtgctggggagaagtgggtgtgtgggtaaaggatag

KEGG   Miniopterus natalensis: 107527637
Entry
107527637         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 8H1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527637
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527637
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527637
NCBI-ProteinID: XP_016055902
LinkDB
Position
Unknown
AA seq 314 aa
MDRRNSTDVSHFVLVGLTGSEGLGRALFTLFLLIYLTSVLGNAGMILLIRLDLQLHTPMY
FFLSHLSFLDLSYSNVITPKTLENLLTSTKHISYVSCFSQLYFFIFLGTTECLLLSSMAY
DRYVAICKPLHYPVVMSSRLCCSLIFGSYGKGFLDSVINVLCMSRLHFCDSNIIHHFFCD
TSPILALSCTDTHDIEIMIFIFAGSTLMGSLTIICGSYLSILSTVLKISSTSGRRKAFST
CASHLLGVTVFYGTLIFTYLRPQKSYSFGKDQVASVFYTIVIPMLNPLIYSLRNQDVKKA
LIRVLQREGSRLLQ
NT seq 945 nt   +upstreamnt  +downstreamnt
atggatagaaggaacagcacagacgtgtctcacttcgtgctcgtggggctgacgggctct
gaggggctcgggcgggccctcttcaccctgtttctcctgatatacctgaccagtgtgctg
ggaaacgcgggcatgatcctgctaatccgcctggatctccagcttcacacccccatgtac
tttttcctcagtcacctgtcatttcttgacctcagttactccaacgtcatcacacctaaa
accttagagaacttactgacttccaccaagcacatttcatacgtgagctgcttcagccag
ctgtacttctttatcttcttgggtaccactgaatgcttacttctctcctcaatggcctat
gatcgctatgtagctatctgcaaacctctacactacccagttgtcatgtcctcaagactc
tgctgctccctcatctttgggtcctatgggaaaggctttttggactcggttatcaatgtg
ctttgcatgagcagactgcatttctgtgactccaacataatccatcactttttctgtgac
acttccccaatcctagccctgtcctgcactgacacacatgacatcgaaatcatgatattc
atttttgctggctccaccctaatgggatctcttaccataatatgtgggtcttatctgtcc
attctgtccactgtcctgaaaatttcctccacttcagggaggagaaaagccttttccacg
tgtgcctcccatctcctgggagtcaccgtcttttatggcactctgatttttacttactta
agaccacaaaagtcctactcctttggaaaggatcaagtggcgtctgtattttacactatt
gtgatccccatgctgaatccactcatctacagtctgagaaatcaggacgtgaaaaaggct
ctcattagagtcctgcagagagagggctcccggctgctacagtaa

KEGG   Miniopterus natalensis: 107527638
Entry
107527638         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 8H1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527638
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527638
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527638
NCBI-ProteinID: XP_016055903
LinkDB
Position
Unknown
AA seq 314 aa
MDRRNSTDVSHFVLVGLTGSEGLGRALFTLFLLIYLTSVLGNAGMILLIRLDLQLHTPMY
FFLSHLSFLDLSYSNVITPKTLENLLTSTKHISYVSCFSQLYFFIFLGTTECLLLSSMAY
DRYVAICKPLHYPVVMSSRLCCSLIFGSYGKGFLDSVINVLRMSRLHFCDSNVIHHFFCD
ISPILALSCTDTQSIEIMIFVFAGSTLMGSLTIICGSYLSILSTVLKISSTSGRRKAFST
CASHLLGVTVFYGTLIFTYLRPRKSYSLGKDQVASVFYTIVIPMLNPLIYSLRNQDVKKA
LIRVLQREGSRLLQ
NT seq 945 nt   +upstreamnt  +downstreamnt
atggatagaaggaacagcacagacgtgtctcacttcgtgctcgtggggctgacgggctct
gaggggctcgggcgggccctcttcaccctgtttctcctgatatacctgaccagtgtgctg
ggaaacgcgggcatgatcctgctaatccgcctggatctccagcttcacacccccatgtac
tttttcctcagtcacctgtcatttcttgacctcagttactccaacgtcatcacacctaaa
accttagagaacttactgacttccaccaagcacatttcatacgtgagctgcttcagccag
ctgtacttctttatcttcttgggtaccactgaatgcttacttctctcctcaatggcctat
gatcgctatgtagctatctgcaaacctctacactacccagttgtcatgtcctcaagactc
tgctgctccctcatctttgggtcctatgggaaaggctttttggactcggttatcaatgtg
cttcgcatgagcagactgcatttctgtgactccaatgtaatccatcactttttctgtgac
atttccccaatcctagccctgtcctgcactgacacacaaagcatagaaatcatgatattc
gtttttgctggctccaccctaatgggatctcttaccataatatgtgggtcttatctgtcc
attctgtccactgtcctgaaaatttcctccacttcagggaggagaaaagccttttccacg
tgtgcctcccatctcctgggagtcaccgtcttttatggcactctgatttttacttactta
agaccacgaaagtcctactccttgggaaaggatcaagtggcgtctgtattttacactatt
gtgatccccatgctgaatccactcatctacagtctgagaaatcaggacgtgaaaaaggct
ctcattagagtcctgcagagagagggctcccggctgctacagtaa

KEGG   Miniopterus natalensis: 107527654
Entry
107527654         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 4D6-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527654
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527654
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527654
NCBI-ProteinID: XP_016055920
LinkDB
Position
Unknown
AA seq 314 aa
MGQSNHTNVREFVFLELTRFPELEFFLFVPFLAVYVATVLGNALIVVTVTWDSHLHIPMY
FLLRNKSVLDIVFSSVTVPKLLMDLLSERKAISYDGCMAQIFLFHFVGGADIFFLSVMAY
DRYLAIAKPLHYVTLMKREVWVALVVASWLGGGLHSIVQIILLLPLPFCGPNTLDAFYCD
VPQVVKLACADTFALQLLMISNNGLVTLLWFLLLLGSYTVILVRLRARSGEGRRKALSTC
TAHVLVLTLHFVPSVYIYCRPFVTLPMDTAVSVNNTVITPMLNPMIYTLRNQEMKSAMKR
LKGRLGPSESSKLG
NT seq 945 nt   +upstreamnt  +downstreamnt
atgggtcagagcaaccacaccaacgtgagggaatttgtcttcctggagctcactcgcttc
ccagagctggagtttttcttgtttgtgcccttccttgctgtgtacgtggcaaccgtgctg
ggcaatgccctcatcgtggtgaccgtcacctgggactcccacctccacattcccatgtac
tttctcctacggaacaaatcggtcctagacattgttttttcatcggtcaccgttcccaag
ttgctgatggatctcttatcagagaggaaagccatctcttacgatggctgcatggcacaa
atcttcctgttccactttgttggtggggcagatatttttttcctctccgtgatggcctat
gacagataccttgcaatcgccaaacccttgcattacgtgacccttatgaagagggaggtg
tgggtggccttggtggtcgcttcctggctgggtggtggcctgcattcaattgtccagatc
attctgctgcttccactccccttctgcggccccaacaccctggacgccttctactgcgac
gtgccccaggtggttaagctggcctgcgcggacaccttcgctctgcagcttctcatgatc
tccaacaatgggctggtgaccctgctgtggttcctcctgctcctggggtcctacactgtc
atcctggtgaggctcagggcccgctctggggagggccggaggaaggccctctccacctgc
accgcccacgtcctggtgctgacccttcactttgtgccgtcggtttacatttactgccgg
ccctttgtcacgctgcccatggacacggctgtgtccgtcaacaacacggtcatcacgccc
atgctgaaccccatgatctacaccctgaggaaccaggagatgaagtccgccatgaagagg
ctgaaggggagacttgggccttctgagagtagtaagctggggtga

KEGG   Miniopterus natalensis: 107527659
Entry
107527659         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5B12-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527659
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527659
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx CsbD
Other DBs
NCBI-GeneID: 107527659
NCBI-ProteinID: XP_016055926
LinkDB
Position
Unknown
AA seq 314 aa
MENSTEATEFLLVGLTDDPSLQIPLFITFSLVYLFTLLGNLGMVHLILSDPRLHSPMYFF
LCNLSLVDIGYSSAVTPQVMAGFLTGEKIIPYNACVTQFFFFVAFITVENFLLASMAYDR
YAAVCKPLHYTSTMTPGVCARLAVGSYACGLLNASVHTGDLFRLSFCRSNVVDHFFCDAP
PLLALSCSDNYVTEMVIFLVVGFNDLFSVLVILISYLFIFLTILRMRSSEGRQKAFSTCA
SHLTVVSIFYGTGIFMYLKPSSSHSMGTDKIASVFYTMVVPMLNPVVYSLRNKEVKGAFK
KAAGKAKSSIGSIF
NT seq 945 nt   +upstreamnt  +downstreamnt
atggaaaacagcaccgaggcgaccgagttccttcttgtggggctgacagatgacccgagc
ctgcagatcccactcttcatcaccttctccctcgtctaccttttcactctgctcgggaac
ctggggatggtccacttgatcctgtccgacccccgcctccacagtcccatgtactttttc
ctctgcaacctctccctggtggacatcggttactcctcagctgtcactccccaggtgatg
gcagggttccttacaggggagaaaatcatcccctacaatgcttgtgtcacccagttcttc
ttctttgtcgctttcatcactgtggaaaatttcctcttggcctccatggcctacgaccgc
tacgcagcagtgtgcaagcccctgcactacaccagcaccatgacacccggggtgtgtgcg
cgtctggccgtaggctcctacgcctgtggcctcctgaatgcctccgtccacaccggggac
cttttcaggctctccttctgtaggtccaacgtggtcgatcactttttctgcgatgctcct
cctctcttggctctctcatgctcagacaactacgtcaccgagatggttatttttttggtg
gtgggtttcaatgacctcttttcggtcctggtcatcttgatctcctacctgtttatattt
ctcaccatcctgaggatgcgttcatctgagggacgccaaaaggccttctcaacctgcgct
tcccacctcactgtggtctccatcttttacgggacaggcatcttcatgtacttaaagccc
agctccagccactccatgggcaccgacaaaatcgcatccgtgttctacactatggtcgtc
cccatgctgaaccctgtggtctacagcctgaggaacaaagaggtcaagggtgcctttaag
aaggctgcagggaaggcaaagtcctctatagggtccatattttaa

KEGG   Miniopterus natalensis: 107527660
Entry
107527660         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 9Q2-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527660
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527660
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 107527660
NCBI-ProteinID: XP_016055927
LinkDB
Position
Unknown
AA seq 314 aa
MAGRNHTVVTEFLLTAFAEHPEWGLPLFLVFLSFYFVTLLGNAGMIVLIHKDRQLRTPMY
FFLGHLSFVDMCYSSVIVPQLLAVLLHHGTAISRARCAAQFFLFTFFASIDCYLLAIMAY
DRYVAVCQPLLYVAVMTEKACRGLVAGAYAAGFASAFVRTVTAFSLSFCGDNEIDFIFCD
LPPLLKLTCGNSFTQEVVIMVFAVFVMPACVLAISASYVFIVVAVAQIRSAGGRARTFST
CASHLAAVSLFFGTLIFMYLRDNAGQPSQEDRVVSVLYTVVTPMLNPLIYSLRNKEVKAA
VRKALSRPEAAGRP
NT seq 945 nt   +upstreamnt  +downstreamnt
atggccgggaggaatcacacggtggtgacagagttcctccttactgccttcgctgagcac
cccgagtgggggctgcctctcttcctggtatttttgagtttctatttcgtcactctgctg
gggaacgcggggatgatcgtcctgatccacaaagatcgccagctccgcacccccatgtac
ttcttcctgggccacctttccttcgtggacatgtgctactcctctgtcatcgtcccccag
ttgctggctgtgctcctgcaccacggcacagccatctcgcgggctcgctgcgcagctcag
ttcttcctcttcaccttctttgcgtccatcgactgctacctgctggccatcatggcctac
gaccgctacgtggccgtgtgccagcccctgctctatgtcgccgtcatgaccgagaaggcc
tgccggggcctggtggccggggcttacgcggctggcttcgccagcgccttcgtgcggacg
gtcacggccttcagcctctccttttgcggagacaacgagatcgactttattttctgcgac
ctccccccgctgttaaaactcacctgtgggaacagcttcacccaggaggtggtgatcatg
gtgtttgccgtttttgtcatgcccgcttgcgtgttggccatctcggcgtcctacgtgttc
atcgtcgtggccgtggcgcagatccgctcggccgggggtcgggccaggaccttctccacc
tgtgcctcgcacctggccgccgtgtcgctcttcttcgggaccctcatcttcatgtacctg
cgggacaacgcgggccagccctcccaagaggaccgggtggtgtctgtgctctacacagtg
gtcaccccgatgctgaaccccctcatctacagcctgaggaacaaggaggtgaaggcggct
gttaggaaggccctgagcaggccggaggctgccgggagaccctag

KEGG   Miniopterus natalensis: 107527661
Entry
107527661         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 9Q1-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527661
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527661
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527661
NCBI-ProteinID: XP_016055928
LinkDB
Position
Unknown
AA seq 311 aa
MAKKNVTLVTEFLLVAFTDRPQRARPLFLLFLFIYLSTLLGNLGMITLIHVDRRLHTPMY
FLLSHLSFTDICYSSVTVPQMMAVLLELGAALSYPRCAAQFFLFTFFGSIDCYLLALMAY
DRYVAVCRPLLYVTVMTQKARLGFVAGAYVAGLFSASVRTVAAFTLSFCGTNAIDFLFCD
LPPLLKLTCGDSYTQEMVIIVITIFVIPACMVVILVSYLFIIVAIMRIPSAGGRTRTFST
CASHLTAVSLFFGTLIFMYLRDSAGQSSEVDRVVSVFYTAVIPMLNPLIYSLRNKEVKAA
LRTILNRTKLS
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcaaagaagaatgtcaccttagtgaccgaattcctcctcgtggcattcacggaccgt
cctcagcgagcacgtcctctcttcctcctgtttctgtttatctatctcagcaccttgttg
gggaacttgggcatgattaccctgatccatgtggatcgccggctgcacaccccaatgtac
ttccttttgagtcacctctctttcacggacatctgctactcgtctgtcactgtgcctcag
atgatggcagtgctgctggagctgggggcagctctgtcctacccgcgctgtgctgctcag
ttcttcctcttcaccttcttcggctccatcgactgctacctgctggccctcatggcctat
gaccgctatgtggccgtgtgccgacccctgctttatgtcaccgtcatgacgcagaaggcc
cgcttgggtttcgtggccggggcttacgtcgccggcctcttcagtgcctcggtgcggaca
gtcgcggcgttcactctctccttctgcggaaccaatgccatcgactttcttttctgtgac
ctccctcctcttttaaagctgacctgtggggacagctacacccaggagatggtcattatt
gtgatcactatttttgttatccctgcctgcatggtggtgatcctggtgtcctacctgttt
atcatcgtggccattatgaggatcccctctgctggaggcaggaccaggaccttctccacc
tgtgcctcgcacctcaccgccgtgtcgctcttcttcgggaccctcatcttcatgtacctg
cgggacagcgcgggccagtcctcagaggtggaccgggtggtgtctgtgttctacacggca
gtcatccccatgctgaaccccctcatctacagcctgaggaacaaggaggtgaaggcggcc
ctaaggacaattctcaacagaaccaagttgtcctaa

KEGG   Miniopterus natalensis: 107527662
Entry
107527662         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 6Q1
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527662
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527662
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527662
NCBI-ProteinID: XP_016055929
LinkDB
Position
Unknown
AA seq 317 aa
MQTYTPNWTHVTEFVMVGFAGVHEARLLLFTLFLTMYLFTLVENLAIIMVVSLDHRLQRP
MYFFLTHLSCLEIGYTSVTVPKMLAGFIGGDGDKNISYAGCLSQLYIFTFLGATECFLLA
AMAYDRYVAICMPLRYEALVSWGTCIRLAGACWLVGFLTPMLPIYLMSQLTFCGSNVVDH
FFCDASPLLALSCSDVTLKETTDLLVSLAVLLASSAVIAVSYGNIVWTLLHIRSAAERWK
AFSTCAAHLTVVSLFYGTLFFMYVRTKVASSINFNKVVSVFYSIVTPMLNPLIYSLRNKE
VKGALSRAISLRSWKGQ
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcagacatataccccaaactggacccacgtaacagagtttgtcatggtgggctttgct
ggggtgcatgaagcacgcctcctcttatttacactcttcctcaccatgtacctctttacc
ttggtggagaacttggccatcatcatggtggtgagtttggaccatcggttacagagaccc
atgtacttcttcttgacacacttgtcgtgccttgaaattgggtatacctcagtcacggtg
cccaagatgctggctggttttattgggggagatggggacaagaatatctcctatgctggc
tgcctctcccagctctacatcttcaccttccttggggcaactgagtgtttcctactggct
gccatggcctatgaccgctatgtggccatttgtatgcctctccgatatgaagccttggta
tcctggggcacctgcatccgtctggctggtgcttgctggctggtgggcttcctcacacct
atgttgcccatctacctcatgtcccagctgacattttgcggctccaatgttgtcgaccac
ttcttctgtgatgcctcacctctgctagccttgtcttgctcggatgtcaccctgaaggag
accacagacttactggtctccctggcggtgctcctggcctcctctgcggtcattgctgtg
tcctatggcaacattgtctggacgctgctgcatatccgctcagcggctgagcgttggaag
gccttttccacttgtgcagctcacctgactgtggtgagcctcttctatggcacccttttc
tttatgtatgtccgaaccaaagtggcctcctccatcaacttcaacaaggtggtatctgtc
ttctactccattgtcacgccaatgctcaaccccctcatctacagtcttcgaaacaaggag
gtaaagggagctctgagcagagccatttccctcaggtcttggaaaggccagtga

KEGG   Miniopterus natalensis: 107527663
Entry
107527663         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 9I1
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527663
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527663
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527663
NCBI-ProteinID: XP_016055930
LinkDB
Position
Unknown
AA seq 314 aa
MAKNNLTTVTNFILVGFTDYPRLETLLFLVFLNFYLVTLLGNVGMVILIQLDVQLHTPMY
FFLSHLSFLDACYTSVITPQILATLATSKTVISFGQCAAQFFFFTICAGTECFLLAVMAY
DRYVAVSNPLLYTAAMNPRICWRFVVGAYVCGTSGAILRTTSTFILSFCDDNQVNFFFCD
LPPLLKLACDDTTNTEIVIVFFGNFVILANAVVILISYLLIIRAILRIKSSGGRAKSFST
CGSHLTAVALLFGTLIFMYLRSGSSKSLEEDKVVSVFYTVVIPMLNPLIYSLRNKDVKAA
FKRVTGRFQVSRSM
NT seq 945 nt   +upstreamnt  +downstreamnt
atggccaagaataatctcaccacagtgaccaacttcattctcgtgggctttacggactac
cccaggttggagactctcctctttctggtgtttctgaatttctatctagtcacccttctg
gggaatgtagggatggttattctgatccaactggatgtccaactccacacaccaatgtac
ttcttcctgagccacctctcctttctagatgcctgctacacctcagtcatcacccctcag
atcctggccacactggccacaagcaagacggtcatctcctttggccaatgcgctgcccag
ttctttttcttcaccatttgcgcaggtacagagtgtttcctgctggcagtgatggcctat
gaccgctatgtcgctgttagcaatccactgctctacactgcggccatgaatcccagaatc
tgctggaggttcgtggtgggagcttatgtctgtgggacatcgggggccatcctgcgtacc
acaagtaccttcatcctctccttctgtgacgacaatcaggtcaacttcttcttctgtgac
ctcccgcccctgctgaagcttgcctgcgatgacacaacaaacaccgagattgtcattgtc
ttcttcggcaactttgtgattttggccaatgctgtggtcatcctgatttcctacctactc
atcatcagggccattttaagaataaagtcttcaggtggcagggctaagtctttctccaca
tgtggctcccatctcactgctgtggcccttctctttgggaccctcatcttcatgtatttg
cggagcggctcaagcaaatccttagaggaagacaaggtcgtgtctgtcttctacactgtg
gtcatccccatgctgaaccctctgatctacagcctgaggaacaaggatgtgaaagcagcc
ttcaaaagggtcactggtcgattccaggtgtctcggagcatgtag

KEGG   Miniopterus natalensis: 107527673
Entry
107527673         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5G3-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527673
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527673
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527673
NCBI-ProteinID: XP_016055940
LinkDB
Position
Unknown
AA seq 310 aa
MEDKNQTAVTEFLFLGLTDHLPQQIALFATLLFIYLVTLGGNLGMITLIWIDSRLHTPMY
FFLSHLSFVDTCSSSSIAPKMLGDIFAEKRGISFMGCAAQMWFFGLFVATECCLLASMAY
DRYMAICKPLFYTLIMSQRVCVQLVAGPYAMALISTMTHTVLTFCLPFCGPNVINHFFCD
ISPLLSLACADTWTNKLVLLILAGAIGVLSGLVITVSYVCILVAILKIQTADGRRKAFST
CSSHLAAVSILYGTLFYIYVFLDSGSSLDINKVISLFYTVVIPMLNPLIYSLRNKEVKDA
FRRKFERKKF
NT seq 933 nt   +upstreamnt  +downstreamnt
atggaagacaagaatcagacggcagtgactgaatttctcttcttgggcctcacggatcat
ctccctcagcagattgccctctttgccacgcttctcttcatctatcttgtcacactgggg
ggaaacttggggatgatcactctcatatggatcgattcccgactccatacccccatgtac
ttttttctcagtcacttgtcctttgtagatacttgttcctcttcttccattgcccccaag
atgctgggtgatatcttcgcagagaagagaggcatctctttcatgggttgtgctgctcag
atgtggttctttggtctttttgtggcaaccgagtgttgtctcctggcttccatggcctat
gacaggtatatggccatctgtaagcccttgttctacacactcattatgtcccagagggtc
tgtgtgcagctggtggcggggccctatgccatggctcttataagcaccatgactcataca
gttctcaccttttgcttacctttctgtggtccaaatgttatcaaccacttcttctgtgac
atttcaccgctgctgtccctggcatgtgcagacacctggaccaacaagttagtgctgctc
atcttggctggagctataggggtactcagtgggctggtcatcacggtgtcctacgtgtgc
atcctggtggccatcctgaagatccagactgctgatgggaggaggaaggcgttctccacg
tgctcttctcacctggcagctgtctccatcctctatgggactcttttctatatctatgtt
tttcttgactcaggttcctccttagatatcaataaagtgatttctctattttatactgtg
gtcatccccatgctgaaccctcttatctacagcttgagaaacaaggaggtgaaggatgct
ttcaggaggaagtttgaaagaaaaaagttctag

KEGG   Miniopterus natalensis: 107527674
Entry
107527674         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 1019
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527674
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527674
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527674
NCBI-ProteinID: XP_016055941
LinkDB
Position
Unknown
AA seq 311 aa
MDKANHSVVTEFIFMGITQDPQLQMIFFVVFLLVYLVNVVGNVGMIILIITDTQLHTPMY
FFLCNLSFVDLGYSSAIAPRMLADFLTKRKVISFSSCATQFAFFVGFVDAECYVLAAMAY
DRFVAICRPLHYSTLMSRRVCLILMLGSYLVGLVSLVAHTSLTFSLSYCGSNIINHFFCE
IPPLLALSCSDTYVSEILLFSLCGFIEASTILIIFISYASILTAIIRMSSAEGRLKAFST
CGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTVIIPMLNPLIYSLRNKDVKAA
FKKLTGGKTQG
NT seq 936 nt   +upstreamnt  +downstreamnt
atggataaagcaaaccactcagtggtgactgagtttatctttatgggcatcacgcaggac
cctcagctgcaaatgatcttctttgtggtcttcctcttggtctacctggtcaatgtagtg
gggaatgttggtatgattatcctgatcataacagacactcagcttcacacacccatgtac
tttttcctctgcaatctttcctttgtcgacctgggctactcctcagctattgctcccagg
atgctggctgacttcctaactaagcgcaaagttatctccttctccagctgtgccacccag
tttgctttctttgtaggttttgtggacgctgagtgctacgtcctggctgccatggcctat
gaccgtttcgtggccatctgccgacccctccactatagcactctcatgtctaggcgagtc
tgcttgattctcatgctgggctcttacctggttggtctggtgagtttagtagctcacact
tctctcaccttcagtctgagttattgtggttccaatatcatcaaccacttcttctgcgaa
atcccaccactcttggctctctcttgctcagacacctacgtcagtgagatcttgctcttt
agtttgtgtggcttcattgaagccagcaccatcctcatcatcttcatttcctatgcctcc
atcctcactgccatcatcagaatgagctccgctgagggccgccttaaggctttctccacc
tgcggatctcacctcactggtgtcacacttttctatggcacagtcatgtttatgtacctg
aggccaacatctagctactccctggaccaagacaagtgggcctctgtgttctacacggtt
atcatccccatgctgaatcccttgatctacagtttaaggaacaaggatgtgaaagctgct
ttcaaaaaactaactgggggaaaaactcaaggataa

KEGG   Miniopterus natalensis: 107527675
Entry
107527675         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 5AP2
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527675
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527675
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 107527675
NCBI-ProteinID: XP_016055942
LinkDB
Position
Unknown
AA seq 317 aa
MIRYMKEVQGRNQTEVTEFILLGLSNNSDLQVVLFGLFLLIYMATMVGNLGMIVLIKIDP
RLHTPMYFFLSGLSFVDACYSSSVTPKMLVNLVTENKAISFNGCAAQFYFFGSFLGTECF
LLAMMAYDRYAAIWNPLLYPVLMSGRICSLLIATSFLAGFGNAAIHTGMTFRLSFCGSNR
INHFYCDTPPLLKLSCSDTHINGIVIMAFSSFNVISCVMIVLISYLCILIAILRMPSLEG
RHKAFSTCASHLMAVTIFFGTILFMYLRPTSSYSMEQDKIVSVFYTVVIPMLNPLIYSLK
NKDVKGALKKILEKHRM
NT seq 954 nt   +upstreamnt  +downstreamnt
atgatcagatatatgaaagaggttcaaggcaggaatcaaactgaagtgacagaatttatc
ctcttaggactctcaaacaactcagatctacaagttgtcctctttggattatttctgtta
atctatatggcaactatggtgggtaatttggggatgatcgtgttgattaagattgaccct
cgtctccacactcccatgtacttctttctcagcggcctctcttttgttgacgcctgctac
tcttcttctgttactcctaagatgctggtgaacctggtgactgagaataaggccatttct
tttaatggatgtgctgcccagttctacttctttggctccttcctggggactgaatgcttc
ctgttggccatgatggcctatgaccgctatgcagccatttggaaccctctgttataccca
gttctcatgtctgggagaatttgctccttgctaatagctacctcattcctagcgggcttt
gggaatgcagctatacacacaggaatgactttcaggttgtccttttgtggctctaatagg
atcaatcatttctactgtgacaccccacccctgctcaagctctcttgctctgacacccac
atcaacggcattgtgatcatggctttctccagttttaatgtcatcagctgtgtaatgatt
gtcctcatttcctacctgtgtatcctcattgccatcttgagaatgccctccttagagggc
aggcataaagccttttctacttgtgcctcccacctcatggctgtcaccatattctttggg
acaattctcttcatgtacttgcgcccaacgtctagctactcaatggagcaggacaagatt
gtttctgtattttatactgtagtgatccctatgctgaatcccctcatctacagtttgaaa
aataaggatgtgaaaggggccctaaagaagatcttggagaaacacagaatgtaa

KEGG   Miniopterus natalensis: 107527676
Entry
107527676         CDS       T05883                                 

Definition
(RefSeq) olfactory receptor 1030-like
  KO
K04257  olfactory receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107527676
G protein-coupled receptors [BR:mna04030]
 Others
  Chemoreception
   Olfactory
    107527676
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107527676
NCBI-ProteinID: XP_016055943
LinkDB
Position
Unknown
AA seq 312 aa
MSRKNYSAVTEFILLGLTDRAELQSVLFVVFLVIYLITVTGNVSMILLIRSYSKLHTPMY
FFLSHLSFVDLCYATNVTPQMLVNFLSKRKTISVIGCFLQFHFFIALVITDYYLLTVMAY
DRYMAICKPLLYASKMSRRVCISLVVIPYTYGFANGLGQTILMLRLSFCGPNEINHFYCA
DPPLLVLACSDTHVKETAMFVVAGSNLTCSLAMIFVSYVFIFTAILRIRSAEGRRKAFST
CGAHLTAVTVFYGTLFCMYLRPPSEASVEQGKVVAVFYIFMSPMLNPLIYSLRNKDVKEA
IRKVTRKKLFAK
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtcaaggaagaactactcagcggtgaccgagtttattctgctgggactgacggacaga
gcggagctccagtctgtccttttcgtggtgttcctggtcatctacctgatcacggtgacc
ggcaacgtgagcatgatcttgttgatcaggagctactcaaagcttcacaccccgatgtat
ttcttcctcagccacctctccttcgtagatctctgctatgccaccaacgtcactcctcag
atgctggttaatttcttatccaagagaaaaaccatttcggtcattggttgcttcctacag
ttccactttttcattgccttggtgatcacagattattatttgctcacagtgatggcttac
gaccgctacatggccatctgcaaacccctgctctatgctagcaagatgtccagacgtgtc
tgcatctcgctcgttgtgattccttacacgtacggctttgcaaatggcctggggcagacc
atcctgatgcttcggctctccttctgcggccccaatgaaatcaaccacttctactgcgca
gaccctcccctcttggtcctggcctgctcggacactcatgtaaaagaaactgccatgttc
gtggtggccgggtccaacctcacctgctccctcgccatgattttcgtctcctacgtgttc
atcttcacagccattctgcgcatccgctccgctgaggggaggcgcaaggccttctccacc
tgcggggcccatctgacagctgtcactgtcttctacgggacgctgttttgcatgtatctg
aggcccccttcggaggcgtctgtagagcaggggaaagtggtagctgtgttctatatcttc
atgagtcctatgttaaatcctttgatctacagtctgaggaacaaagatgtgaaagaagca
atcaggaaagttacccgaaagaaactgtttgctaaataa

KEGG   Miniopterus natalensis: 107527678
Entry
107527678         CDS       T05883           &nbs