KEGG   Miniopterus natalensis: 107523800
Entry
107523800         CDS       T05883                                 

Gene name
PDIA4
Definition
(RefSeq) protein disulfide-isomerase A4
  KO
K09582  protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107523800 (PDIA4)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107523800 (PDIA4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107523800 (PDIA4)
   04131 Membrane trafficking [BR:mna04131]
    107523800 (PDIA4)
Enzymes [BR:mna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     107523800 (PDIA4)
Chaperones and folding catalysts [BR:mna03110]
 Protein folding catalysts
  Protein disulfide isomerase
   107523800 (PDIA4)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107523800 (PDIA4)
SSDB
Motif
Pfam: Thioredoxin OST3_OST6 Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Calsequestrin Thioredoxin_7 AhpC-TSA TraF HyaE Radial_spoke
Other DBs
NCBI-GeneID: 107523800
NCBI-ProteinID: XP_016050977
LinkDB
Position
Unknown
AA seq 545 aa
MQNTGSAGEPRYRDSSKEEAVEEEDEEEEEEEDLEVKEENGVLVLSDANFDDFVADKDTV
LLEFYAPWCGHCKQFAPEYEKIASTLKENDPPIPVAKIDATSETALASRFDVSGYPTIKI
LKKGQAVDYEGSRTQDEIIAKVKEISQPNWTPPPEVTLVLTKDNFDEVVDGADIILVEFY
APWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDAIAETDLAQRFGVSSYPTLKIFRKGK
PFEYNGPREKYGIVDYMIEQSGPPSKEILALKQVQEFLKDGDDVIIIGVFQAESDPAYQL
YQEAANNLREDYKFHHTFSTEIAKFLKVSPGKLVMMQPEKFQSKYEPRSNVMDIQGSTEG
SAIKDFVLKHTLPLVGHRKPANDAKRYARRPLVVVYYSVDFSFDYRAGKLKPVIKSQPVP
KNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYASLGKKYKSHKNLVI
AKMDATANDITSDRYKVEGFPTIYFAPSGDKKNPIKFEDGNRDLEHLSKFIEEHATKPSR
TREDL
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgcaaaacacaggcagtgcaggggagcctcgctacagggattccagtaaagaagaggcc
gtggaggaggaagacgaggaggaggaggaagaggaggacctggaagtcaaggaggaaaac
ggcgtgctcgtcctcagtgacgccaacttcgacgacttcgtggccgacaaggacaccgtg
ctgctggagttctacgctccgtggtgcggacattgcaagcagtttgctccagagtatgaa
aaaatcgccagtaccttgaaagagaacgaccctcccattcctgtcgctaagatagacgcg
acctcagagacagcgctggccagcaggttcgatgtgagcggctaccccaccatcaagatc
ctcaagaaggggcaggctgtcgactacgagggctccaggacccaggacgaaattatcgcc
aaggtcaaggagatctcccagcccaactggacgcctccaccggaagtcacactcgtgctg
accaaagataacttcgacgaggtggtggatggtgcagacatcatcctggtggagttttac
gctccctggtgtggacactgcaagaagctggcccccgagtatgagaaggctgccaaggag
ctgagcaagcgctctcccccaatccccctggccaaggtggacgccatcgcggagacagac
ctggcgcagaggttcggtgtctccagctatcccaccctgaagatcttccgcaagggaaag
cctttcgaatacaatggcccgcgagagaaatacgggattgttgactacatgatcgagcag
tccgggccaccctccaaggagatcttggccctgaagcaggtccaggagttcctgaaggat
ggagacgatgtcatcatcattggggtcttccaggcggagagtgacccggcctaccagctg
taccaggaagctgctaacaacctgagggaagattacaaattccaccacaccttcagcact
gaaatagcaaagttcttgaaagtctcccctgggaagctggtcatgatgcagcctgagaaa
ttccagtccaaatacgagcccaggagcaacgtgatggacatccagggctccacggagggc
tcggccatcaaggacttcgtgctgaagcacacgctgcccctcgtgggtcaccgcaagccc
gccaacgacgccaagcggtacgcgcggcgccccctggtggtcgtgtactacagcgtggac
ttcagcttcgactaccgagcgggaaaactgaagccggtcatcaaatcccagccggtgccc
aagaacaacaagggacctgtcaaggtcgtggtggggaagaccttcgactccatcgtgatg
gaccccaagaaggacgtgctcatcgagttctacgcgccctggtgcgggcactgcaagcag
ctggagcccgtgtacgcctccctgggcaagaagtacaagagccataagaacctggtcatc
gccaagatggatgccactgccaacgacatcaccagcgaccgctacaaagtcgagggcttc
cccaccatctacttcgcgcccagtggggacaaaaagaacccgattaagtttgaggacgga
aacagagacctggaacatttgagcaagtttatagaggaacatgccacaaaacccagcagg
accagggaagacctttaa

DBGET integrated database retrieval system