KEGG   Miniopterus natalensis: 107523893
Entry
107523893         CDS       T05883                                 

Gene name
CDC16
Definition
(RefSeq) cell division cycle protein 16 homolog isoform X1
  KO
K03353  anaphase-promoting complex subunit 6
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107523893 (CDC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107523893 (CDC16)
   04114 Oocyte meiosis
    107523893 (CDC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107523893 (CDC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107523893 (CDC16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107523893 (CDC16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107523893 (CDC16)
   03036 Chromosome and associated proteins [BR:mna03036]
    107523893 (CDC16)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107523893 (CDC16)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107523893 (CDC16)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107523893 (CDC16)
SSDB
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_8 TPR_7 TPR_10 TPR_19 TPR_11 TPR_9 TPR_16 SRP_TPR_like Dynein_light
Other DBs
NCBI-GeneID: 107523893
NCBI-ProteinID: XP_016051054
LinkDB
Position
Unknown
AA seq 620 aa
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYESCRYLAARCHYAAKEHQQALDILDMEEPINKRLFEKYLKDESGLKDPSND
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLESLPLSKLCTEEQELLRFLFENKLKKYNKPSETIIPDSVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFGQALSIAPEDPFVMHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTTEETGLTPLETSRKTPDSRPSLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaacctggagcggctgcggaagcgagtccggcagtacctggaccagcaacagtatcaa
agtgctctattttgggcagataaagtagcttcactctctcatgaggaaccccaggacatt
tattggttggctcaatgtctttacctgacagctcaatatcatagagcagctcatgcactt
cggtcacgaaaactggacaaattgtatgaatcatgccgctaccttgcagctaggtgccat
tatgctgcgaaagagcatcagcaggctctcgacattcttgatatggaggagccaatcaac
aaacgattatttgagaagtacttaaaggatgaaagtggcttgaaagacccctccaatgac
tgggaaatgtcacagtcctcaataaagagttctatttgtcttttacgagggaaaatctat
gatgctctagataacagaaccctagctacctatagctataaagaagctttgaagctcgat
gtctactgttttgaagcatttgatcttctgacgtcacaccacatgttgacagcccaagaa
gaaaaagaacttcttgaatcactacctcttagtaagctctgtactgaagaacaggaattg
ctacgttttctatttgagaacaaattaaaaaagtataataaaccaagtgaaactatcatc
ccggactctgtagatggtttgcaagagaatctggatgtggtagtgtctttagctgaaaga
cattattataactgtgattttaaaatgtgctacaagcttacttctgtagtgatggaaaaa
gatcctttccatgcaaattgcttacctgtacatatagggacacttgtagagctgaataaa
gcaaacgaacttttctatctttctcataaattggtggatttatatcctagcaaccctgtg
tcttggtttgcagtgggatgctattatctcatggttggtcataagaatgaacatgccaga
agatatctcagtaaagctacgacactcgagaagacctacgggcctgcgtggatagcatat
ggacattcgtttgcagttgagagtgaacatgaccaagcaatggctgcttacttcacagca
gcacagctgatgaaagggtgtcatttgccaatgctgtatattggattagagtatggactg
accaataactcaaaattggctgagagattctttggccaagctctgagcattgcaccagaa
gatccttttgttatgcatgaagttggcgtggttgcatttcaaaatggagaatggaaaaca
gcagaaaaatggtttctagatgctttggaaaaaataaaagcaattggaaatgaggtaact
gttgacaaatgggaacctttgttgaacaacttggggcatgtctgcagaaaacttaaaaag
tatgcagaggcattggattatcaccgtcaggcactggtgttaattccgcaaaacgcatct
acctattctgccatagggtatatccatagtctgatgggcaactttgaaaatgctgtggac
tatttccatacagcccttggtcttaggcgagatgatacattttctgttacaatgcttggt
cattgcattgaaatgtacattggtgattctgaagcttatattggagcagacattaaagac
aaattaaaatgttatgactttgatgtgcatacaatgaagacgctaaaaaacattatctca
cctccgtgggatttcagggaatttgaagtagaaaaacagactacagaagaaacggggctt
acaccactggaaacctcaaggaaaactccagattccagaccttctttggaagaaaccttt
gaaattgaaatgaatgaaagtgacatgatgttagagacatctatgtcagaccacagtacg
tga

KEGG   Miniopterus natalensis: 107529590
Entry
107529590         CDS       T05883                                 

Gene name
ANAPC5
Definition
(RefSeq) anaphase-promoting complex subunit 5 isoform X1
  KO
K03352  anaphase-promoting complex subunit 5
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04657  IL-17 signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107529590 (ANAPC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107529590 (ANAPC5)
   04114 Oocyte meiosis
    107529590 (ANAPC5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107529590 (ANAPC5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107529590 (ANAPC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107529590 (ANAPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107529590 (ANAPC5)
   03036 Chromosome and associated proteins [BR:mna03036]
    107529590 (ANAPC5)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107529590 (ANAPC5)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107529590 (ANAPC5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_2 TPR_10 TPR_7 MapZ_EC1
Other DBs
NCBI-GeneID: 107529590
NCBI-ProteinID: XP_016058541
LinkDB
Position
Unknown
AA seq 655 aa
MAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQ
QYFQNGEKKAAEDTDMELTREEGERKMEKEELDLSVREEEVSCSGPLSQKQAEFFLSQQA
SLLKNDETKALPPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDR
LILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCL
QHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMD
ALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLESVSAGVQQ
NNTESFAVALCHLAELHAEQGCFAAASEVLRHLKERFPPNSQHAQLWMLCDQKIQFDRAM
HDGRYHLADSLVTGITALHSTEGVYRKAVVLQAQSQMTEAHKLLQKLLVHCQKIRNTEMA
ISVLLSVAELHWRSSSPAAALPALLQALALSREYRLQYLASETVLNLAFAQLILGIPEQA
LSLLHMAIEPILADGAVLDKGRAMFLVAKCQVASVASCDPPGKAEALEAAIENLNEAKNY
FSKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggccgaaggcgaattgaaggatatggaacaattttttgatgacctgtcagattctttt
tctggaactgaaccagaggttcacaaaacaagtgtagtaggcttatttctgcgtcacatg
atcttggcctacagtaagctttctttcagccaagtgttcaaactgtacaccgccctgcag
cagtacttccagaacggcgagaagaaggccgcggaggacactgacatggagctgacccgg
gaagagggcgagcggaaaatggaaaaggaggagctggacctgtccgtgagagaagaggag
gtatcttgcagtgggcctctgtcccaaaaacaagcagagttttttctttctcaacaggcc
tctttgttgaagaatgacgagacgaaagccctccctccagcgtctttgcagaaagaattg
aacaacttgctgaaatttaatcctgattttgctgaagcgcattacctcagctacttaaac
aacctccgggtccaggatgttttcagctctacacacagcctcctgcattacttcgaccgc
ctgatccttactggagccgaaagcaaaagtaatggggaggagggctatggccggagcttg
cggtacgcggctctgaacctggccgccctgcactgccgcttcgggcactatcagcaggcg
gagctcgccctgcaggaggccatcaggatcgcccaggagtccaatgatcatgtgtgtctc
cagcactgcctgagctggctttacgtgctggggcagaagagatctgatagctacgttctg
ctggagcattctgtgaagaaagcggtgcatttcgggttaccgtacctggcctccctgggc
atacagtctctggttcagcagagggcgtttgctgggaagacagcaaacaaactgatggat
gccctaaaggactccgacctcctgcactggaaacactccctgtcagagctcatcgacatc
agcatcgcccagaagacagccatctggaggctctatggccgcagcaccatggcgctgcag
caagcccagatgttgctgagcatgaacagcctggagtcggtgagcgcgggcgtgcagcag
aacaacaccgagtccttcgccgtcgcactctgccacctcgcagagctacacgccgagcag
ggctgtttcgctgcagcttccgaagtgttaaggcacctgaaggagagattcccacccaat
agtcagcatgcccagctgtggatgctgtgtgatcagaaaatccagtttgacagagcaatg
cacgacggcaggtatcatttggcggattcgctcgttacgggaatcacagcgcttcatagc
acagagggcgtctacaggaaggcagtcgtcctccaggcccagagccagatgacagaggca
cacaagctcctccagaagctgttggttcactgtcagaaaatcaggaacacggaaatggcc
atcagtgtcctgctgtcggtggcagagctgcactggcgctcctcctccccggccgccgcg
ctgcccgcgctcctgcaggccctggccctctccagggagtaccggctgcagtacttggcc
tccgaaacggtgctgaacttggcttttgcccagctcatcctcggaatcccagaacaggcc
ttaagtctcctgcacatggccatcgagcctatcttggccgacggagctgtgctggacaaa
ggccgggccatgttcttggtggccaagtgccaggtggcctcagtagcttcctgcgatcct
ccgggcaaggcagaagcgctggaggccgccattgagaacctcaacgaagccaagaactat
ttttcaaaggtcgactgcaaagagcggatcagagacgtcgtttacttccaggcccggctc
taccacaccctggggaagacccaggagaggaaccgctgtgcgatgctcttccggcagctg
caccaggagctgccctcccacggggtgcccttgataaaccatctctag

KEGG   Miniopterus natalensis: 107529596
Entry
107529596         CDS       T05883                                 

Gene name
ANAPC7
Definition
(RefSeq) anaphase-promoting complex subunit 7 isoform X1
  KO
K03354  anaphase-promoting complex subunit 7
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107529596 (ANAPC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107529596 (ANAPC7)
   04114 Oocyte meiosis
    107529596 (ANAPC7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107529596 (ANAPC7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107529596 (ANAPC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107529596 (ANAPC7)
   03036 Chromosome and associated proteins [BR:mna03036]
    107529596 (ANAPC7)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107529596 (ANAPC7)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107529596 (ANAPC7)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_14 TPR_19 TPR_16 TPR_1 ANAPC3 TPR_7 TPR_11 TPR_12 ChAPs TPR_21 TPR_17 TPR_10 BTAD
Other DBs
NCBI-GeneID: 107529596
NCBI-ProteinID: XP_016058549
LinkDB
Position
Unknown
AA seq 598 aa
MDPGEAAILEFSLRFSYRLLVPLPPLPAALPGRMNVIDHVRDMAAAGLHSNVRLLSSLLL
TMSNNNPELFSPSQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTG
NSTSTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKK
AGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIK
AYAFVHTGDNSRAINTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLD
PYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYL
GAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASN
SIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALNQRPDYIKAVVK
KAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPN
DQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggaccccggcgaagccgccattttggagttttctctaaggttctcctaccggcttttg
gtgccgctgccaccgctccccgcggccttgccgggcaggatgaatgtgatagaccacgtg
cgagacatggcggccgctgggctgcactccaacgtgcggctcctcagcagcttgttactt
acaatgagtaataacaaccctgagttattctccccatctcagaagtaccagcttttggtg
tatcacgcagattctctgttccatgataaggagtatcgcaatgctgtgagtaagtatacc
atggctttacagcagaagaaagccctaagtaaaacttcaaaagtgaggccttcaactggc
aattctacatccactccacaaagtcagtgtcttccatctgaaattgaagtgaaatacaaa
atggctgaatgttacacaatgctaaaacaagataaagatgccattgctatacttgatggg
atcccttcaagacaaagaactcccaaaataaacatgatgctggcaaacttgtacaagaaa
gctggtcaggagcgcccttcagtcaccagctataaggaagtgctgaggcaatgcccatta
gctcttgatgccattctgggtttgctgtcgctatcggtaaaaggtgcagaggtggcatca
atgaccatgaacgtgatccagaccgtgcctaacttggactggctctctgtgtggatcaaa
gcatatgcttttgtgcatactggtgacaattcaagagcaatcaataccatctgttctcta
gagaaaaagtcattattgcgagataacgtggatctactgggaagcttagcagatctgtac
ttcagagctggagacaataaaaactctgtcctcaaatttgaacaagcacagatgttggat
ccttatctgataaaaggaatggatgtatatggctacctcctggcacgagaagggcggctg
gaagatgtggagaatcttggctgccgccttttcaatatttctgatcagcatgcagaacct
tgggtagtctctgggtgtcatagcttctatagcaaacgctactcccgggccctctattta
ggagccaaggccattcagctgaacagtaatagtgttcaggctttgctgcttaagggagca
gcactcaggaacatgggcagagtccaagaagcaataatccactttcgggaggctatacgg
cttgcaccttgtcgcttagactgttatgaaggtctcatcgagtgttacttagcttccaac
agtattcgtgaagcaatggtaatggctaacaacgtttacaaaactctaggagcaaatgca
cagacccttaccctgttagccactgtttgtctcgaagacccagtgacacaggaaaaagct
aaaactttattggataaagccctgaaccaaaggccggattacattaaggctgtggtgaaa
aaagcagaactacttagcagagagcagaaatacgaagatggaattgcgctgctgaggaac
gcactagctaatcagagtgactgtgtcctgcatcggatcctaggagatttccttgtagct
gtcaatgagtatcaggaagcaatggaccagtatagtatagcactaagtttggaccccaat
gaccagaagtctctagaggggatgcagaagatggagaaggaggagagtcccacggacgcc
actcaggaggaggatgtggacgacatggaagggagtggggaagaaggggacctggagggc
agcgacagtgaggcggcccagtgggccgaccaggagcagtggttcggcatgcagtga

KEGG   Miniopterus natalensis: 107530120
Entry
107530120         CDS       T05883                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle protein 23 homolog isoform X1
  KO
K03355  anaphase-promoting complex subunit 8
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107530120 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107530120 (CDC23)
   04114 Oocyte meiosis
    107530120 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107530120 (CDC23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107530120 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107530120 (CDC23)
   03036 Chromosome and associated proteins [BR:mna03036]
    107530120 (CDC23)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107530120 (CDC23)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107530120 (CDC23)
SSDB
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_17 TPR_16 ANAPC3 TPR_12 TPR_9 DUF772 TPR_15
Other DBs
NCBI-GeneID: 107530120
NCBI-ProteinID: XP_016059257
LinkDB
Position
Unknown
AA seq 597 aa
MAASSSVVPVALTAPVVPILSASGDFSNLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPPLPLAELQPPPPLTEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYTCGEIVEHLEESTAFRYLAQYYFRCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPSTEMPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggccgcgagctcctctgtagtccctgtggccctgacggcacccgtggtaccgatcttg
tcagcgagtggcgatttctcaaatttgcgggaaattaaaaagcagctgctacttatcgcc
ggcctcacccgggagcggggcttgctgcacagtagcaaatggtcggcggagttggccttc
tccctcccgccgttgcctctggccgagctgcagccgccgccgcctcttacagaggaggat
gcccaggatatggatgcttacaccctggccaaggcctactttgatgtaaaagagtatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctatttcctgtacatgtat
tccagatatctgtctggagaaaagaagaaggatgatgaaacagttgatagcctaggccct
ctggaaaaaggacaagtaaaaaatgaggctcttagagaattgagagtggagctcagcaaa
aagcaccaggctcgggaacttgatggatttggcctttatctgtatggtgttgtgcttcga
aaactggacttggtgaaagaggccattgatgtatttgtggaggctactcatgttttgcct
ttgcattggggagcctggctagaactctgtaacttgattacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaagccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcgtatattgtttcccaaattgcagttgcctatcacaatatcagagatattgat
aaagccctctctatttttaatgagttaaggaaacaagacccttacaggattgagaatatg
gacacattttccaaccttctttatgtcaggagcatgaaatctgagttgagttatctggct
cacaacctctgtgagattgataaatatcgtgtggaaacttgctgtgtaattggcaattat
tatagtttgcgttctcagcacgagaaagcagccttgtatttccagagagccttgaaattg
aatcctcggtatcttggggcctggacactgatgggacatgagtacatggaaatgaagaac
acatctgctgctattcaggcttacagacatgccattgaggtcaataagcgggactacaga
gcctggtacggccttgggcaaacctatgaaatccttaagatgccgttttactgcctttat
tattatagacgggcccatcagcttcggcccaatgattctcgtatgctggttgctttagga
gaatgttatgagaaactcaatcaacttgtggaagccaaaaagtgttattggagagcttat
gctgtgggagatgtggagaaaatggctctggtgaaactcgcaaagcttcatgaacagttg
actgaatcagaacaggctgcacagtgttacatcaaatatatccaagatatctatacatgt
ggggaaatagtggaacacttggaggagagcacagctttccgctatctggcccagtactat
tttaggtgcaagctgtgggatgaagcttcaacttgtgcccaaaagtgttgcgcattcaat
gatacccgggaagaaggtaaagctttgctccggcaaatcctgcagcttcggaaccaagga
gagactccttccaccgagatgcctgctccctttttcctccctgcatcactgtctgctaac
aacactcctacacgcagagtttctccgctcaacctatcttcagtcacaccatag

KEGG   Miniopterus natalensis: 107530322
Entry
107530322         CDS       T05883                                 

Gene name
CDC27
Definition
(RefSeq) cell division cycle protein 27 homolog isoform X1
  KO
K03350  anaphase-promoting complex subunit 3
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107530322 (CDC27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107530322 (CDC27)
   04114 Oocyte meiosis
    107530322 (CDC27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107530322 (CDC27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107530322 (CDC27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107530322 (CDC27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107530322 (CDC27)
   03036 Chromosome and associated proteins [BR:mna03036]
    107530322 (CDC27)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107530322 (CDC27)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107530322 (CDC27)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107530322 (CDC27)
SSDB
Motif
Pfam: TPR_1 ANAPC3 TPR_2 TPR_8 TPR_12 TPR_16 TPR_11 TPR_17 TPR_19 TPR_14 TPR_6 TPR_9 ChAPs TPR_MalT PPTA
Other DBs
NCBI-GeneID: 107530322
NCBI-ProteinID: XP_016059532
LinkDB
Position
Unknown
AA seq 702 aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSNCL
PNSCTTVVSNHNLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPPTGAPSKKTFCVLQSVARIGQTGTKSVFSQSGNSREVTPVLVAQTQSSG
PQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKT
SKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAGLMSLLREMGKGYL
ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVE
GMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAI
QVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLA
EMHFQKALDINPQSSVLLCHIGVVSSFLNIVQSFSLLRCVCY
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccattatgct
taccgagatgcagttttccttgcagaacgactgtatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcaatgtaaatacctgcttgcgaaatgttgtgtt
gatctcagcaagcttgctgaaggggaacagatcttatctggtggagtgtttaataaacag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtatattgcaaaacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacctctttacagaactttagcaactgtctg
cccaactcttgtacaacagtagtatctaatcataatttatctcacagacagcctgagaca
gttcttacggaaacaccccaggacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtattccttgaatacagattcctcagtgtcttatattgattcggctgtaatt
tcaccagatactgtcccccttggaacaggaacttctatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagcttattaggaggaccggctgctcttagcccattaaccccc
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccacccaccggagccccttcaaaaaagact
ttttgtgttttacagtctgttgccagaatcggacaaactggaacaaagtctgtcttctca
cagagtggaaatagtcgagaggtaactccagttcttgttgcacaaacacaaagttctggc
ccacaaacaagtacaacacctcaggtattgagccccactatcacatctcccccaaatgca
ctgcctcgaagaagttcacgactttttactagtgacagctctacaaccaaggagaatagc
aaaaaattaaaaatgaagtttccacctaaaatcccaaacagaaaaacaaaaagtaaaact
agtaaaggaggaataactcagcctaacataaacgatagcttggaaattacaaagctggac
tcttccatcatttcagaagggaaaatctccaccatcacacctcagatccaggcatttaat
ctacagaaggcagcagcaggtttgatgagccttcttcgtgagatggggaaaggttattta
gctttgtgttcatacaactgcaaagaagctataaatatcttgagccacctaccttctcat
cactacaatactggttgggtactgtgccaaattggaagggcctattttgaactttcagag
tacatgcaagctgaaagaatattctcagaagttagaagaattgagaattatagagttgaa
ggcatggagatctactctacaacactgtggcatcttcaaaaggatgttgctctttcagtt
ctttcaaaagacttaacagatatggataaaaattcaccagaggcctggtgtgctgcaggg
aactgtttcagtttgcaacgggagcatgacattgcaattaaattcttccagagggctatt
caggttgatccaaattatgcttatgcctatactctattagggcatgagtttgtcttaact
gaagaattagacaaagcattagcttgttttcgaaatgctatcagagtcaatcctagacat
tataatgcatggtatggtttaggaatgatttattacaagcaagaaaaattcagccttgca
gaaatgcatttccagaaagcacttgatatcaaccctcaaagttcagttttactttgccac
attggagtggtaagtagcttcctaaacattgttcagtcattctcccttttgagatgtgtt
tgttattga

KEGG   Miniopterus natalensis: 107532521
Entry
107532521         CDS       T05883                                 

Gene name
ANAPC10
Definition
(RefSeq) anaphase-promoting complex subunit 10 isoform X1
  KO
K03357  anaphase-promoting complex subunit 10
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107532521 (ANAPC10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107532521 (ANAPC10)
   04114 Oocyte meiosis
    107532521 (ANAPC10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107532521 (ANAPC10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107532521 (ANAPC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107532521 (ANAPC10)
   03036 Chromosome and associated proteins [BR:mna03036]
    107532521 (ANAPC10)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107532521 (ANAPC10)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107532521 (ANAPC10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 107532521
NCBI-ProteinID: XP_016062406
LinkDB
Position
Unknown
AA seq 185 aa
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccacaccaaacaagacacctcctggcgctgaccctaagcagctggaaaggactgga
acggtacgggaaattggctcacaagctgtttggtcactctcatcttgcaaaccaggattt
ggagtggatcaattacgagatgacaatctagaaacttattggcaatcggatggctcccag
cctcatttagtgaacattcaattcaggagaaaaacaacggtgaagacattatgtatttat
gcggactacaaatctgatgaaagttatactccaagcaaaatctcagtcagagtaggaaat
aatttccacaaccttcaagaaattcggcaacttgaattggtggaaccaagtggctggatt
cacgttcccttaactgataatcataagaagccaactcgcacattcatgatacagattgct
gttctagccaatcaccaaaatggaagagacacccacatgagacaaattaaaatatataca
ccagtggaagagagctccattggtaaatttcctagatgtacaactattgattttatgatg
tatcgttcaataaggtga

KEGG   Miniopterus natalensis: 107535457
Entry
107535457         CDS       T05883                                 

Gene name
CDC26
Definition
(RefSeq) anaphase-promoting complex subunit CDC26 isoform X1
  KO
K03359  anaphase-promoting complex subunit 12
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107535457 (CDC26)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107535457 (CDC26)
   04114 Oocyte meiosis
    107535457 (CDC26)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107535457 (CDC26)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107535457 (CDC26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107535457 (CDC26)
   03036 Chromosome and associated proteins [BR:mna03036]
    107535457 (CDC26)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107535457 (CDC26)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107535457 (CDC26)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 107535457
NCBI-ProteinID: XP_016066405
LinkDB
Position
Unknown
AA seq 85 aa
MLRRKPTRLELKLDDIEEFESIRKDLETRKKQREDVDVVGGSDGEGAIGLSSDPKSREQV
INDRIGYKPQAKPNNRSSQFGSFEF
NT seq 258 nt   +upstreamnt  +downstreamnt
atgttgcgacgaaaaccaacccgcctggagctgaagcttgatgacattgaagagtttgaa
agcattcgaaaagacttggagacccgtaagaaacaaagggaagatgtggatgtcgtagga
ggcagtgatggagaaggggccatagggctcagcagtgaccccaagagtcgggaacaagtg
attaatgatcgaattggttataaacctcaagccaagcccaacaatcgttcatctcaattt
ggaagttttgaattttag

KEGG   Miniopterus natalensis: 107536147
Entry
107536147         CDS       T05883                                 

Gene name
ANAPC2
Definition
(RefSeq) anaphase-promoting complex subunit 2
  KO
K03349  anaphase-promoting complex subunit 2
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107536147 (ANAPC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107536147 (ANAPC2)
   04114 Oocyte meiosis
    107536147 (ANAPC2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107536147 (ANAPC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107536147 (ANAPC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107536147 (ANAPC2)
   03036 Chromosome and associated proteins [BR:mna03036]
    107536147 (ANAPC2)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Cullin
     107536147 (ANAPC2)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107536147 (ANAPC2)
SSDB
Motif
Pfam: Cullin ANAPC2
Other DBs
NCBI-GeneID: 107536147
NCBI-ProteinID: XP_016067260
LinkDB
Position
Unknown
AA seq 791 aa
LITCSPFQASSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFIEVLQNDLQANISLEF
WNALSQRENCADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLRD
KVHTTLRGVLFFSTPRTFQEMVQRLYGRFLRVYMQSKRKGEGGTDPELEGDLDSRYARRR
YYRLLQSPLCAGCGSDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTITLHQVTRE
RMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGPTLRRWRCHVQRF
FYRMYAGLRIEELFSIIRDFPDSRPAVEDLKYCLERTDQRQQLLVSLKAALETRLLHPGV
NTCDIITLYISAIKALRVLDPSVVILEVACEPVRRYLRTREDTVRQIVAGLTGDSDGTGD
LAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPGKSSSKRRSSDIISLLVSIYGS
KDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRIN
ANIREEDEKRPPEEQPPFGVYAVILSSEFWPPFKEEKLEVPGGVREALEAYCRKYEKLKA
MRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVVLLYFQDQASWTLEALSKVVKMPVAL
LRRRMAVWLQQGVLREEPPGTFSVVEEERPQDRDNMVLIDSDDESDSGMASQADQKEEEL
LLFWTYIQAMLTNLESLSLERIYSMLRMFVVTGPALAEIDLQELQAFLQKKVRDQQLVYA
AGVYRLPKSCS
NT seq 2376 nt   +upstreamnt  +downstreamnt
ctcatcacctgctccccctttcaggcgtcctcccggaccagcggtgcagtcccgccaaag
gaggaggagctgcgggcagctgtggaggttctgaggggccacggcctgcactcggtcctg
gaggagtggttcatagaggtgctgcaaaatgacctgcaggccaacatctccctcgagttc
tggaatgccctctcccagcgcgagaactgtgcggacgagccccagtgccttctgctgctc
ctcgacgctttcgggttgctggagagccgcctggacccctacctgcgcagcctagagctc
ctggagaaatggactcgcctgggcttgctgatgggcaccggcgctcaggggctgcgggac
aaagtccataccacgttgcggggtgtcctcttcttctccactcccaggacctttcaggaa
atggtccagcgtctctatgggcgcttcttgagagtctacatgcagagtaagaggaaagga
gaagggggcacagacccagaactggagggggacttggacagcaggtatgcccgccgccgg
tactaccggcttctgcagagccctctgtgtgcgggatgtggcagtgataagcagcagtgt
tggtgccgccaggcgctggagcagttccaccagctcagccaagtcctgcacaggctcagt
ctgctggagcgggtcagtgccgaggctgtgaccatcaccctgcaccaggtgacccgggag
aggatggaggaccgctgccggggcgagtacgagcgctccttcctgcgcgagttccacaag
tggatcgagagggtggtcggctggctgggcaaagtgttcctgcaggacggccctgccagg
cccgcatcccctgaggccggccccacactgcgccgctggcgttgccacgtgcagaggttc
ttctaccgcatgtacgccggcctgcgcatcgaagagctcttcagcatcatccgagacttc
ccagactcccggcctgccgttgaggacctaaagtactgcctggagagaactgatcagagg
cagcagctgctcgtgtccctcaaggctgccctagagacacgacttctccacccaggcgtc
aacacgtgtgacatcatcactctctacatctccgccatcaaggcgctgcgtgtgctggac
ccctccgtggtcatcctggaggtggcctgtgagcctgtccgccgctacctgaggacacgg
gaggacacggtacggcagattgtggctgggctaacgggggactcggacgggactggggac
ttggctgtggagctgtccaagacggacccggcgagcctggagacaggccaggacagcgag
gacgactctggcgagcccgaggactgggtccccgaccccgtggatgctgatccagggaag
tccagctccaagcggcgctcctcggacatcatcagtctgctggtcagcatctacggcagc
aaggacctgttcatcaacgagtaccgctcgctgctggccgaccgcctgctgcaccagttc
agcttcagccccgagcgggagattcgcaacgtggagctgctgaagctgcggttcggcgag
gcccccatgcacttctgcgaggtcatgctgaaggacatggccgactcccgccgaatcaac
gccaacatccgagaggaggatgagaagcggcccccggaggagcagccgccatttggggtc
tatgccgtcatcctgtccagcgagttctggccccccttcaaggaggagaagctggaggtc
cctggcggcgtcagggaagccctggaggcctattgcaggaagtacgagaagctgaaggcc
atgcggaccctcagctggaagcacacactgggcctggtgaccatggacgtagagctggca
gaccgcaccctgtctgtggccgttacccctgtgcaggccgtggtcttgttatacttccag
gaccaagccagctggaccctggaggcgctgagcaaggtggtgaagatgccggtggcgctg
ctgcggaggcggatggcggtgtggctgcagcagggcgtgctgcgggaggagcccccgggc
accttctcggtggtggaggaggagcggccccaggaccgggacaacatggtgctcatcgac
agtgacgacgagagcgactctggcatggcctcccaggccgaccagaaggaagaggagctg
ctgctcttctggacgtacatccaggccatgctgaccaacctggagagcctgtcgctggag
cgcatctacagcatgctgcgcatgttcgtggtcaccgggcccgctctggccgagatcgac
ctgcaggagctgcaggccttcctgcagaagaaggtgcgggaccagcagctggtctatgcg
gccggcgtgtaccgcctgcccaagagctgcagctga

KEGG   Miniopterus natalensis: 107539093
Entry
107539093         CDS       T05883                                 

Gene name
ANAPC11
Definition
(RefSeq) anaphase-promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107539093 (ANAPC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107539093 (ANAPC11)
   04114 Oocyte meiosis
    107539093 (ANAPC11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107539093 (ANAPC11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107539093 (ANAPC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107539093 (ANAPC11)
   03036 Chromosome and associated proteins [BR:mna03036]
    107539093 (ANAPC11)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     107539093 (ANAPC11)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107539093 (ANAPC11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-C3HC4 MIX zf-Nse zf-RING_11 zf-RING_5 zf-C3HC4_3 zf-RING_4 zf-RING_UBOX
Other DBs
NCBI-GeneID: 107539093
NCBI-ProteinID: XP_016070964
LinkDB
Position
Unknown
AA seq 91 aa
MTLLKPVFSERPWPPCLTSWVPRLGPTWLLHALRDPHPILSRAGKVPGDDCPLVWGQCSH
CFHMHCILKWLNAQQVQQHCPMCRQEWKFKE
NT seq 276 nt   +upstreamnt  +downstreamnt
atgactctcctgaaacctgtcttctctgagaggccctggccaccctgtctaacgtcctgg
gttccccgtcttggtcccacctggctattgcatgctctgcgtgacccacaccctatcttg
tcccgtgcaggtaaggtgccaggtgacgattgtccgctggtctggggccaatgctcccac
tgcttccacatgcactgcatcctcaagtggctgaatgcgcagcaggtgcagcagcactgc
cccatgtgtcgccaagaatggaagttcaaggaatga

KEGG   Miniopterus natalensis: 107539636
Entry
107539636         CDS       T05883                                 

Gene name
ANAPC1
Definition
(RefSeq) anaphase-promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107539636 (ANAPC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107539636 (ANAPC1)
   04114 Oocyte meiosis
    107539636 (ANAPC1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107539636 (ANAPC1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107539636 (ANAPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107539636 (ANAPC1)
   03036 Chromosome and associated proteins [BR:mna03036]
    107539636 (ANAPC1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107539636 (ANAPC1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107539636 (ANAPC1)
SSDB
Motif
Pfam: APC1_C ANAPC1 PC_rep
Other DBs
NCBI-GeneID: 107539636
NCBI-ProteinID: XP_016071685
LinkDB
Position
Unknown
AA seq 1943 aa
MSNFYEERATMIAAGDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGGSEIGEVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDS
PVQQALWCDFIISQDKSEKAYSSAEVEKCICILQSSCINMHSIEGKDYIASLPFQVASVW
PTKYGLLFERSSSSHEVPPGLPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVVD
HAMKIVFLSTDPSIVMTYDTVQSLHSVWVLRRVKAEEENAVLKFSEPGGTPQNVAPSSSL
TGNLRSLSKGDSPVTSPFQNYSSVHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGVH
SFTGVQRFNLSSHNQSPRRHSISHSPDSNSNSSFLAPETEPIVPELCIDHLWTEAITNTR
EKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSITNIQAKDAAP
VEKIGTMLVLESSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNPMPRPSTPLDSVSTPTPL
SKLLGSLDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVRNRVTLELSN
GSMVRITLPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYSVHSAPGGPSYHSEWNLFV
TCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDEDWEYLLNSDYHQKVES
HLLNRSLCLSPLEVSQMKDEDLSQNLSLDSSTLLFSHIPAMFFVLHLVYEELKLNTLMGE
GIHSLVDLLVQLARDLKLEPYLDHYYRDYPTLVRTTGQVCTIDQGQTGFMHHPSFFTSEP
PSIYQWVSSCLKGEEMPPYPYLPGICERSRLVVLSIALYILGDESSVCDESSRYLSRITL
APQKSQAEQEENRFSFRHSPSVSSLAERLVVWMANVGFTLRDLETLPFGIALPIRDAIYH
CREQPAADWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNQ
EVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALP
VGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGV
AAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGH
EMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVY
QGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNV
PEQLYQYMVGGHRRFQAGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNNR
SIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISL
SEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSA
PNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMA
LGILFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVP
VDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLS
KGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAF
TSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAVRRLG
RREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCSIDNTLDQWLQ
AGGDVCVHAYLSGQPWEESQLSMLACFLVYHSVPAPRHLPSVGLEGSTSFAELLFKFKQL
KMPVRALLRLAPLLLGNPQPMVM
NT seq 5832 nt   +upstreamnt  +downstreamnt
atgtcgaacttctatgaagaaagggcaacaatgattgcagctggggatttgcaggaattt
gttcctttcggtcgagaccactgcaaacaccaccctaatgctttgaaccttcagcttcgg
cagctgcagccagcctctgagttatggtcgtccgatggtgctgctggcttggtgggatcc
ctgcaggaggttacaatccacgagaaacagaaggaaagctggcagttaaggaaaggtgga
agcgaaattggagaagtggattatgatgaggaactctatgtggctggaaatatggtgatc
tggagcaaaggaagtaaaagccaggccttggctgtttataaagcctttacagttgatagt
cctgttcaacaggcattgtggtgtgacttcattatatcacaggataagtctgaaaaagcc
tacagtagtgctgaagtagaaaaatgtatatgtatattgcaaagctcatgtatcaacatg
catagcatagaaggaaaggattacatagcttctttaccttttcaggttgcaagtgtttgg
cccaccaaatatggattgttgttcgaacgaagcagttcttcacatgaggtacctccaggt
ctacccagagaacctttgcccactatgttcagcatgctgcatccactagatgaaataacc
ccacttgtttgtaaatctggaagtctttttggttcatcacgggtgcaatacgttgtagat
catgcgatgaaaatagtttttctcagcactgacccctccattgtaatgacctatgacact
gttcagagtctacattctgtgtgggttctacggagagtcaaagcagaggaagagaatgct
gttttaaaattctctgaaccggggggaactcctcagaatgtggccccgagtagctccctc
acagggaacctcagaagcctctccaaaggagactcccctgtgacctccccgttccagaat
tactcctccgtccacagtcagagtcgctccacctcctcacccagtctgcattctcgctct
ccttctatctccaacatggcggctctaagtcgtgctcattcccctgccttaggggtccac
tctttcaccggggtgcaaaggttcaacctttcaagccataatcaatctccacggagacac
agtatttctcattctccagatagtaattcaaatagctcttttcttgcaccagaaacagag
ccaattgttcctgaactttgtattgatcatttatggacagaggcaattactaacacaagg
gagaaaaattcacaggcctcaaaagtgttcattacatctgacctatgtgggcaaaagttc
ttgtgctttttagtagagtcccagctccagttacgctgtgtaaagtttcaagagagtaat
gataagactcagctcatctttggctccatcaccaacatacaggcaaaggatgcagcacca
gtggagaagataggcaccatgctggtcctggaaagcagtggaaaccttgtgctgtacaca
ggagtggttcgggtgggaaaggtttttattcctgggctgccagctccttccctgacaatg
tctaatccaatgcctcggcccagcactccactcgacagcgtcagcactcctacacctctg
agtaaattgcttggatccttggatgaggtggttctgttgtccccagttccagaactaagg
gattcttcaaaactccatgattctctctataatgaggattgtactttccaacagcttgga
acgtacattcattctataagagaccctgtccgaaacagagtgactctagagctgagtaat
ggctccatggtgaggatcacgcttcctgaaattgccacgtctgaattagtgcaaacatgt
ttgcaagcaattaagtttatcctgccaaaagaaatagctgttcagatgctcgtcaagtgg
tacagtgtccacagtgctccaggcggacccagctatcactcagagtggaatttattcgtg
acttgtctcatgaacatgatgggttataacacagaccgcttagcgtggacaaggaatttt
gactttgaaggatcactttccccagtaattgcacccaaaaaagcaaggccttctgagaca
gggtctgatgaggattgggaatatttactgaattcagactaccaccagaaggttgagtct
caccttttgaatagatctttatgtctgagtcctttggaagtttctcagatgaaggatgag
gacttgtcacagaatctcagtctggattcttctacccttctcttctctcacatacctgca
atgttttttgttcttcacctcgtctacgaggaacttaaattgaatactctgatgggggaa
ggaattcattcgcttgttgacctccttgttcagttggcaagggacttaaaattggagcct
tacttagatcattactacagagattacccaacgcttgtcagaactactggacaagtgtgc
acaattgatcaaggtcaaacagggtttatgcatcatccatcattttttacttctgagcca
ccaagtatttatcagtgggtgagttcttgtctgaagggtgaagaaatgccaccgtaccct
tacctccctggcatctgtgaaagaagccgacttgtagttttgagtattgcgctctacatt
cttggtgatgaaagctctgtttgtgatgaatcctcacgctatttatcgagaataactcta
gctccccaaaagtcacaagcagaacaagaggaaaacaggtttagtttcaggcattctcca
tcagtttctagtctagctgaaagattagttgtctggatggctaatgtaggcttcacttta
agagacttggaaactcttccctttggaattgctcttcccatcagagatgcaatttatcac
tgtcgcgagcagcctgctgcagactggccagaggctgtgtgtctcttgattggacgtcag
gacctgtccaagcaggcctgtgaaggaaacttacccaaagggaaatctgtgctctcatca
gatgttccttcaggaacagagactgaggaggaagatgatgggatgaatgacatgaatcaa
gaagttatgtcactcatatggagtgaagatttaagggtgcaagacgtgcggaggcttctt
caaagtgcgcatcctgtccgcgtcaatgtggtgcagtacccagagctcagtgaccacgag
ttcattgaggagaaggaaaacagattgctccagttgtgccagcgaactatggcacttccg
gtaggacgagggatgtttaccttattttcataccatcctgttccaacagaaccattgcct
attcctaagttgaatttgactgggcgtgcccctcctcggaacacaacagtagaccttaac
agtggaaacattgatgtgcctcccaacatgacaagctgggctagttttcataatggtgtg
gctgccggcctgaagatagccccggcctctcagattgactcagcctggattgtttacaat
aagcccaagcatgctgaactagccaatgagtatgctggcttcctcatggccctgggcctg
aatggacacctcaccaagctggccactctgaacatccatgactacctgaccaagggtcat
gaaatgacaagcattggactactccttggtgtttctgctgctaagctgggcaccatggat
atgtccattacgcggctgcttagcatccacattcctgctctcttacccccaacgtccacg
gagcttgatgttccccacaacgtccaggtggctgcagtggtcggcattggccttgtatat
caagggacagctcacaggcatactgcagaagtcctgctggctgaaataggacggccccct
ggtcctgaaatggaatactgcactgacagagagtcctactctttagctgcgggcttggcc
ctgggcatggtctgcttggggcatggcagtaatttgataggtatgtctgacctcaatgtg
cctgagcagctttatcagtacatggttggaggtcataggcgttttcaagcaggaatgcac
agggagaaacataaatctccaagttatcaaatcaaagaaggagataccataaatgtggat
gtaacttgtccaggtgccactcttgctttggctatgatctacttaaaaaccaataacaga
tccattgccgattggcttcgagctcctgacaccatgtatttgctggactttgtgaaaccg
gagtttctcttgcttaggacacttgctcgatgcctgattttgtgggatgatattttacca
aattccaagtgggttgatagcaatgttcctcaaattataagagaaaatagtatctctctc
agtgaaattgaattgccttgctcagaggatttgaatctggaaactttgtcgcaagcacat
gtctacataattgcaggagcctgtttgtccctgggttttcgatttgctggctcagaaaac
ttatcagcatttaactgtttgcataaatttgcaaaagattttatgacttatttgtctgca
cccaatgcttccgtgacaggtccttacaacctggagacgtgcctgagtgtggtgctgctg
tctctggccatggtcatggctggctcagggaacctaaaggttttgcagctttgtcgtttc
ttgcacatgaaaacaggtggtgaaatgaactatggttttcacttagcccaccacatggcc
cttggaattctgtttttgggaggaggaaggtactctttgagcacctcaaactcctccatt
gccgctctcctctgcgccctttacccgcacttcccagctcacagcactgacaatcggtac
catctccaagctctgcggcacctgtacgtgctggctgcagaaccacggctgctagtgcct
gtggatgtggacacaaacacgccctgctatgccctcttagaagttacctataagggtact
cagtggtatgagcaaaccaaagaagaactgatggctcccacccttcttccagagctccac
cttttaaagcagattaaagttaaaggcccccggtactgggaactgctcatagatttaagc
aagggaactcagcacttaaagtcaatcctttccaaggatggggttttatatgttaagctc
agagcaggccagctctcctacaaggaagatccaatgggatggcagagtctattggcccag
actgttgctaacaggaactccgaagctcgggctttcaagcctgaaacaatttcagcattc
acttccgatccagcacttctgtcatttgctgagtatttctgcaagcccactgtgaacatg
ggtcagaaacaggaaattctggatctgttttcttcagtgctctatgagtgtgttactcaa
gagaccccggagatgctgcctgcatacatagcaatggaccaggctgtaagaagactggga
agaagagaaatgtctgagacatctgaactttggcagataaagttggtgttggagtttttc
agctccagaagccatcaggagcggctgcagaaccacccaaagcgggggctcttcatgaac
tccgagttcctgcccgttgtaaaatgctctattgataacacactggaccagtggctacaa
gctgggggagatgtgtgtgtgcatgcctacctcagtgggcagccctgggaggagtcgcag
ctgagcatgctggcctgcttccttgtctaccactccgtcccagctccacggcacctgcca
tccgtaggactagaagggagcaccagctttgcagaactcctcttcaaatttaaacagctg
aaaatgcccgtgcgagctctgctaagattggctcctttgcttcttggaaacccacagcca
atggttatgtga

KEGG   Miniopterus natalensis: 107541233
Entry
107541233         CDS       T05883                                 

Gene name
ANAPC4
Definition
(RefSeq) anaphase-promoting complex subunit 4 isoform X1
  KO
K03351  anaphase-promoting complex subunit 4
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107541233 (ANAPC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107541233 (ANAPC4)
   04114 Oocyte meiosis
    107541233 (ANAPC4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107541233 (ANAPC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107541233 (ANAPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107541233 (ANAPC4)
   03036 Chromosome and associated proteins [BR:mna03036]
    107541233 (ANAPC4)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107541233 (ANAPC4)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107541233 (ANAPC4)
SSDB
Motif
Pfam: ANAPC4 ANAPC4_WD40
Other DBs
NCBI-GeneID: 107541233
NCBI-ProteinID: XP_016073725
LinkDB
Position
Unknown
AA seq 807 aa
MLRFPTCFPSFRVVGEKQLPQEIIFLAWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTA
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIVGTCLALCLSSDLKSLSVVTEVSATGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYVNLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAVGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVEKVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKP
ADVIGKSMNQAICIPLYKDTRSEDATRRLVKFPFLWNNKTLNLHYLLFTVLEDSLHKMCI
LRRHTDISQSVSNGLIAVKFGSFTYATTEKVRRSTYSCLDAQFYDDETVTVVLKDTVGRE
GRDRLLVQLPLSLVYNCEDSAEYQFTGTYSTRLDEQCDAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDDEEVTSKPVTVKEEALSEPEA
ESQPARASALAPEGVVKVEKLGPELDS
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgttgcggtttccgacctgtttcccgtccttccgggtggtgggagagaagcagctgccg
caggagatcattttcctggcctggtcacccaagcgggatctcatcgccttggccaacacc
gcgggcgaggttttacttcatcgacttgcaagttttcatagagtttggagtttcccacca
aatgaaaatacaggaaaggaagtgacttgcctagcttggagaccagatggcaaacttttg
gcctttgctcttgctgacaccaagaaaatagttttgtgtgatgtagaaaaacctgaaagc
ttacactccttttctgtggaggctccggtttcttgtatgcattggatggaagtgactgca
gaaagcagtgttctaacatctttttataatgctgaagatgaatctaatcttctcttacct
aagctacctacattgccaaaaaattatagcaacacctcaaaaatatttagtgaagaaaat
tctgatgaaattattaagcttttgggagatgtcaggcttaatattcttgtccttggagga
agctctggttttattgaactttatgcttacggaatgttcaaaattgcccgagtcacaggg
attgttggcacttgtcttgccttgtgtttatcaagtgacttgaaatcattatccgtggtc
acagaggtatctgccacaggtgcttcagaggtttcatactttcagcttgaaaccaatcta
ttgtactctttcttacctgaagtaactcggatggccaggaagtttactcacatttcagct
cttttacagtatgtaaatttgtcactaacatgtatgtgtgaagcatgggaggaaatactg
atgcagatggactctcgtctcaccaagtttgtgcaggaaaagaacacaaccacatcagtg
caggatgaattcatgcacttgctgttgtgggggaaagctagtgctgaacttcagaccctc
ttaatgaaccagttaacagtgaagggcttaaaaaagcttggccagtctatagagtcatcg
tattccagtatacaaaaattggttataagtcacttacagagtggctcagagtctctattg
taccatctaagtgagctgaaaggaatggcttcatggaagcaaaaatatgaacctcttgga
ttagatgctgtaggaattgaagatgctattactgctgtgggttctttcatactcaaggca
aatgaacttcttcaagttatagatagtagtatgaaaaacttcaaagcattttttcggtgg
ctctatgtggcaatgctgagaatgacagaagaccacgtgcttcctgagctgaataagatg
actcaaaaagatatcacatttgttgccgaatttcttactgaacatttcaatgaggctcca
gacctttataatcgaaaaggaaaatactttaatgttgaaaaagttggtcagtacttgaaa
gatgaagatgacgatcttgtgtcaccccctaacacagaaggaaaccagtggtatgacttt
cttcaaaacagcagccaccttaaagaaagccctttgctgttcccttattatcctcgaaaa
tcattgcactttgtgaaaaggcggatggagaacattattgatcaatgtttgcaaaagcca
gcagatgtaattggaaaatcaatgaatcaagcaatctgtatcccattatataaagataca
agaagtgaggacgctacacgcagattggtcaaattcccttttctgtggaataataagact
ttaaatctccattaccttctttttactgtgttagaagattcgctccataaaatgtgcatc
ctaaggaggcatactgatatttcccaatctgtaagcaatggactaattgctgttaaattt
gggagctttacatatgccacgactgagaaagtgagaagaagcacctacagttgtttagat
gcacagttttatgatgatgaaactgtaacggtagttctgaaggacactgtaggacgtgag
ggaagagatagactcttggtccagttgccattgtctttagtatataactgtgaagattct
gcagaatatcagttcactgggacttactctacaaggctagatgaacagtgtgatgctatt
cctacacgcaccatgcatttcgagaagcactggagattgctggaaagtatgaaagcccag
tatgttgctgggaatggttttcgaaaagtgtcctgtgtgttaagctcaaacctccgtcac
gtgagagtgtttgaaatggacatagacgatgagtgggagctggacgagtcttccgacgac
gaggaggtgaccagtaagcctgtgacagtaaaggaggaggcgctgtccgagccagaggct
gagagccagccagcccgtgcctctgccttggccccggagggagtcgtcaaagtggaaaaa
ctgggccctgagctggactcctag

KEGG   Miniopterus natalensis: 107546107
Entry
107546107         CDS       T05883                                 

Gene name
ANAPC13
Definition
(RefSeq) anaphase-promoting complex subunit 13
  KO
K12456  anaphase-promoting complex subunit 13
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107546107 (ANAPC13)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107546107 (ANAPC13)
   04114 Oocyte meiosis
    107546107 (ANAPC13)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107546107 (ANAPC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107546107 (ANAPC13)
   03036 Chromosome and associated proteins [BR:mna03036]
    107546107 (ANAPC13)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107546107 (ANAPC13)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107546107 (ANAPC13)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 107546107
NCBI-ProteinID: XP_016079864
LinkDB
Position
Unknown
AA seq 74 aa
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
ALQYLHENVPPVGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atggacagtgaagtacagagagatggaaggatcttggatctgattgacgatgcttggcga
gaagataagctgccctatgaggatgttgcaatcccactgaatgagcttcctgaacctgag
caggacaatggtggcaccacagaatctgttaaagaacaagagatgaagtggaccgacttg
gctttacagtacctgcatgagaatgtgcctccagtaggaaactga

DBGET integrated database retrieval system