KEGG   Miniopterus natalensis: 107523913
Entry
107523913         CDS       T05883                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X1
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
mna  Miniopterus natalensis
Pathway
mna01523  Antifolate resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04068  FoxO signaling pathway
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04380  Osteoclast differentiation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04623  Cytosolic DNA-sensing pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05212  Pancreatic cancer
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107523913 (IKBKB)
   04014 Ras signaling pathway
    107523913 (IKBKB)
   04064 NF-kappa B signaling pathway
    107523913 (IKBKB)
   04668 TNF signaling pathway
    107523913 (IKBKB)
   04068 FoxO signaling pathway
    107523913 (IKBKB)
   04151 PI3K-Akt signaling pathway
    107523913 (IKBKB)
   04150 mTOR signaling pathway
    107523913 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107523913 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107523913 (IKBKB)
   04621 NOD-like receptor signaling pathway
    107523913 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    107523913 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    107523913 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    107523913 (IKBKB)
   04660 T cell receptor signaling pathway
    107523913 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    107523913 (IKBKB)
   04659 Th17 cell differentiation
    107523913 (IKBKB)
   04657 IL-17 signaling pathway
    107523913 (IKBKB)
   04662 B cell receptor signaling pathway
    107523913 (IKBKB)
   04062 Chemokine signaling pathway
    107523913 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107523913 (IKBKB)
   04920 Adipocytokine signaling pathway
    107523913 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107523913 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107523913 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107523913 (IKBKB)
   05206 MicroRNAs in cancer
    107523913 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107523913 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107523913 (IKBKB)
   05221 Acute myeloid leukemia
    107523913 (IKBKB)
   05220 Chronic myeloid leukemia
    107523913 (IKBKB)
   05215 Prostate cancer
    107523913 (IKBKB)
   05222 Small cell lung cancer
    107523913 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107523913 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107523913 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107523913 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    107523913 (IKBKB)
   04931 Insulin resistance
    107523913 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107523913 (IKBKB)
   05135 Yersinia infection
    107523913 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107523913 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    107523913 (IKBKB)
   05161 Hepatitis B
    107523913 (IKBKB)
   05160 Hepatitis C
    107523913 (IKBKB)
   05171 Coronavirus disease - COVID-19
    107523913 (IKBKB)
   05164 Influenza A
    107523913 (IKBKB)
   05162 Measles
    107523913 (IKBKB)
   05168 Herpes simplex virus 1 infection
    107523913 (IKBKB)
   05163 Human cytomegalovirus infection
    107523913 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107523913 (IKBKB)
   05169 Epstein-Barr virus infection
    107523913 (IKBKB)
   05165 Human papillomavirus infection
    107523913 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107523913 (IKBKB)
   05142 Chagas disease
    107523913 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107523913 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107523913 (IKBKB)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     107523913 (IKBKB)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107523913 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Glyco_hydro_65m Med20 GTSE1_N
Other DBs
NCBI-GeneID: 107523913
NCBI-ProteinID: XP_016051094
LinkDB
Position
Unknown
AA seq 777 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
KDIVVFEDLNGAVKFSSSLPYPNNLNSVLAQLLEKWLQLMLMWQPRQRGTDPVYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVSEDESLQSLKARIGQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDGKLNEGRTLDMDLVFLFDNSKVTYETQISPRPQPESVSCILQEPKRN
LPFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGQLFLQENEVKHLVER
MMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQ
AIQAFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWN
LLKIACSKVRGPVSGSPDSMNASRLSHSGQLMSQPPTAPDSLPESVDKREELVAEAHTLC
TQLESAMQDAMKEQDQSLRVMACVNPIYPMCFLQQMRKRKWKGNPAFPQPQYSLMIF
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgccaacccagacatgtggggcctgggaaatgaaagaacga
cttgggacagggggatttggaaacgtcatccgatggcacaatcaggaaacgggtgagcag
attgctatcaagcagtgccggcaagagctcagcccccggaatcgagagcgatggtgcctg
gagatccagatcatgagaaggctcaaccatcccaatgtggtggctgcccgggatgtccca
gaggggatgcagaacttggctcccaacgacttgcccctcctggccatggaatactgccaa
ggaggagatcttcgaaagtacctgaaccagtttgagaactgctgtggtctgcgggaagga
gccatcctcaccttgctgagtgacattgcctctgcacttagataccttcacgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtccttcagcaaggagagcaaagatta
atacacaaaattattgacctaggatatgccaaggaactggatcagggcagtctctgtact
tcctttgtggggaccctccagtacctggctccggaactgctggagcagcagaaatacacg
gtgactgtcgactactggagctttggcaccttggctttcgagtgcatcacaggcttccgg
cctttcctccccaactggcagcctgtgcagtggcattccaaggtccggcagaagagtgag
aaggacatcgttgttttcgaagacttgaacggagcagtgaagttttcgagctctttacct
taccccaataatcttaacagcgtcctggcacaactactggagaagtggctgcagctgatg
ctaatgtggcaaccccgacaaaggggcactgatcctgtgtatgggcccaatggctgcttc
aaggccctggatgacatattaaacttaaagctggttcatatcttgaacatggtcacaggc
accattcacacctatccagtgtcagaagatgagagtctacagagcttaaaggccagaatc
gggcaggacacaggaatccctgaggaggaccaggagctgctgcaagaagcgggtctggca
ttgatccccgacaagcctgctactcagtgtatttcagatggcaagctaaatgagggccgc
acactggacatggatcttgtttttctctttgacaacagtaaagtcacctatgagactcag
atctccccacgtcctcaacctgaaagtgtcagctgtatccttcaagagcccaagaggaac
ctgcctttcttccagctgcggaaagtatggggccaggtctggcacagcatccaaaccctg
aaggaggactgtaaccggctgcagcagggacagcgagctgccatgatgaatctcctccgg
aataacagctgcctctccaagatgaagaattccatggcctccatgtctcagcagctcaaa
gccaagttggatttctttaagaccagcatccagattgacctggagaagtatagtgagcaa
actgagtttgggatcacatcagataaactgctgctggcctggagggaaatggaacaggct
gtggagctctgtgggcagctttttcttcaggagaatgaagtgaaacatctggtggagcgg
atgatggcactgcagacagacatcgtggacttgcagaggagcccaatgggtcggaagcag
gggggaacgctggatgacttagaagagcaagcgagggagctttacaggagactcagggaa
aaaccaagagaccagcgaactgagggtgacagtcaggagatggtgcgactgctacttcag
gcaatccaagcctttgagaagaaagtgcgagtgatttatacacagctcagtaaaactgtg
gtttgcaagcagaaggctctggaattgttgcccaaggtggaagaggtggtgagtttaatg
aatgaggatgagaagactgtggttcggcttcaggaaaagcgacagaaggagctctggaat
ctcctgaagatcgcttgtagcaaggtccgtggtcctgttagtggaagcccagatagcatg
aatgcttctcgccttagtcactctggtcagctgatgtctcagcctcccactgccccggac
agcttacctgagtcagtcgacaaacgtgaagaactggtggccgaagcacacactctctgc
acccagctagaaagtgcaatgcaagatgccatgaaagaacaggaccagagtttacgggta
atggcctgtgtgaaccccatctatcccatgtgctttctacagcagatgagaaaaagaaaa
tggaaaggcaacccagcatttcctcaacctcagtattcacttatgattttctag

KEGG   Miniopterus natalensis: 107542599
Entry
107542599         CDS       T05883                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
mna  Miniopterus natalensis
Pathway
mna01523  Antifolate resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04068  FoxO signaling pathway
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04380  Osteoclast differentiation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04623  Cytosolic DNA-sensing pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04920  Adipocytokine signaling pathway
mna05010  Alzheimer disease
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05212  Pancreatic cancer
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107542599 (CHUK)
   04014 Ras signaling pathway
    107542599 (CHUK)
   04064 NF-kappa B signaling pathway
    107542599 (CHUK)
   04668 TNF signaling pathway
    107542599 (CHUK)
   04068 FoxO signaling pathway
    107542599 (CHUK)
   04151 PI3K-Akt signaling pathway
    107542599 (CHUK)
   04150 mTOR signaling pathway
    107542599 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107542599 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107542599 (CHUK)
   04621 NOD-like receptor signaling pathway
    107542599 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    107542599 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    107542599 (CHUK)
   04625 C-type lectin receptor signaling pathway
    107542599 (CHUK)
   04660 T cell receptor signaling pathway
    107542599 (CHUK)
   04658 Th1 and Th2 cell differentiation
    107542599 (CHUK)
   04659 Th17 cell differentiation
    107542599 (CHUK)
   04657 IL-17 signaling pathway
    107542599 (CHUK)
   04662 B cell receptor signaling pathway
    107542599 (CHUK)
   04062 Chemokine signaling pathway
    107542599 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107542599 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107542599 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542599 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107542599 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107542599 (CHUK)
   05221 Acute myeloid leukemia
    107542599 (CHUK)
   05220 Chronic myeloid leukemia
    107542599 (CHUK)
   05215 Prostate cancer
    107542599 (CHUK)
   05222 Small cell lung cancer
    107542599 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107542599 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107542599 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107542599 (CHUK)
   05135 Yersinia infection
    107542599 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107542599 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    107542599 (CHUK)
   05161 Hepatitis B
    107542599 (CHUK)
   05160 Hepatitis C
    107542599 (CHUK)
   05171 Coronavirus disease - COVID-19
    107542599 (CHUK)
   05164 Influenza A
    107542599 (CHUK)
   05162 Measles
    107542599 (CHUK)
   05168 Herpes simplex virus 1 infection
    107542599 (CHUK)
   05163 Human cytomegalovirus infection
    107542599 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107542599 (CHUK)
   05169 Epstein-Barr virus infection
    107542599 (CHUK)
   05165 Human papillomavirus infection
    107542599 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107542599 (CHUK)
   05142 Chagas disease
    107542599 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107542599 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107542599 (CHUK)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     107542599 (CHUK)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107542599 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 107542599
NCBI-ProteinID: XP_016075464
LinkDB
Position
Unknown
AA seq 746 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHSNVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTASQELLSETGI
SLDPRKPASQCVLEGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVRDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNTNLTKMKNALISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMCLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKHLKHRPSDHFYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADSTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTTPQASAWLPPTSAEREHPLSCVVTPQDGESLTQMIEENLNCLGH
LNTIIHEVNEEKSSRMMNLDWSWLTE
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggagcggcccccagggctgcggccgggcgcgggcgggccctgggaaatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgcctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgtctagagctgagtaccaaaaacagagaacggtggtgccat
gaaattcagatcatgaaaaagttgaaccactccaacgttgtaaaggcctgtgatgttcct
gaggaattgaattttttgattaacgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccggaagctactcaacaaaccagaaaattgctgcggacttaaagaaagccag
atactttctttactgagtgatatagggtctgggatccgatatttgcatgaaaacaaaatt
atacatcgtgatttaaagcccgaaaacatagttcttcaggatgttggtggaaagattata
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacattgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattactggagctttgggaccatggtgtttgaatgtattgctggatataggcct
tttttacaccacctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgacaggagaagttcggtttagtagtcatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctgcagttgatgctg
aattgggaccctcagcagagaggaggacctgttgatcttactttgaagcagccaagatgt
tttgtattaatggatcacattctaaatttgaagatagtgcacatactaaatatgacttct
gcaaagataatttcttttctcttaccacctgatgaaagtcttcattcactgcagtctcgt
attgagcgtgaaactggaataaatactgcttctcaagagcttctttcagagacgggaatt
tctcttgatcctcggaaaccagcctctcaatgtgttctagaaggagtaagaggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacgggacagcaaaatacagcttccaatt
atacagctgcgtaaagtatgggctgaagcagtgcactatgtgtctgggctaaaagaggac
tatagccggctctttcagggacaaagagcagccatgttaagtcttcttagatataatact
aacttgacaaaaatgaagaacgccttgatctcagcatctcagcaattgaaagctaaactg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgagcagatgacttat
gggatatcctcagaaaaaatgttaaaagcatggaaggaaatggaagaaaaagctatccac
tatgctgaggtaggtgtcattggatacctggaggatcagatcatgtgcctgcacactgaa
atcatggagctacagaaaagcccttatggaagacggcagggagacttgatggaatctctg
gaacagcgtgccattgatctatataagcacttaaagcacagaccttcagatcacttctac
agtgacagcacggagatggtgaagatcattgtgcatactgtgcagagtcaggaccgggtt
ctgaaggagctgtttggtcatctgagcaagttgttgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtaacatcaaagaagctgacagtactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttcggctcggtcccttgtaggatccagtctagaaggtgcagtaactacccctcaggca
tcagcatggctgcccccgacttcagcagaacgtgaacatcctctgtcatgcgtggtaact
cctcaagatggggagtccttgacacaaatgatagaagaaaatttgaactgtcttggccat
ttaaacactattattcatgaagtaaatgaggaaaagagtagtaggatgatgaatcttgac
tggagttggttgacagaatga

KEGG   Miniopterus natalensis: 107544156
Entry
107544156         CDS       T05883                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
mna  Miniopterus natalensis
Pathway
mna01523  Antifolate resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04380  Osteoclast differentiation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04623  Cytosolic DNA-sensing pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04920  Adipocytokine signaling pathway
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05212  Pancreatic cancer
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05340  Primary immunodeficiency
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107544156 (IKBKG)
   04014 Ras signaling pathway
    107544156 (IKBKG)
   04064 NF-kappa B signaling pathway
    107544156 (IKBKG)
   04668 TNF signaling pathway
    107544156 (IKBKG)
   04151 PI3K-Akt signaling pathway
    107544156 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107544156 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107544156 (IKBKG)
   04621 NOD-like receptor signaling pathway
    107544156 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    107544156 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    107544156 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    107544156 (IKBKG)
   04660 T cell receptor signaling pathway
    107544156 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    107544156 (IKBKG)
   04659 Th17 cell differentiation
    107544156 (IKBKG)
   04657 IL-17 signaling pathway
    107544156 (IKBKG)
   04662 B cell receptor signaling pathway
    107544156 (IKBKG)
   04062 Chemokine signaling pathway
    107544156 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107544156 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107544156 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544156 (IKBKG)
   05203 Viral carcinogenesis
    107544156 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107544156 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107544156 (IKBKG)
   05221 Acute myeloid leukemia
    107544156 (IKBKG)
   05220 Chronic myeloid leukemia
    107544156 (IKBKG)
   05215 Prostate cancer
    107544156 (IKBKG)
   05222 Small cell lung cancer
    107544156 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    107544156 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107544156 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107544156 (IKBKG)
   05135 Yersinia infection
    107544156 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107544156 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    107544156 (IKBKG)
   05161 Hepatitis B
    107544156 (IKBKG)
   05160 Hepatitis C
    107544156 (IKBKG)
   05171 Coronavirus disease - COVID-19
    107544156 (IKBKG)
   05164 Influenza A
    107544156 (IKBKG)
   05162 Measles
    107544156 (IKBKG)
   05168 Herpes simplex virus 1 infection
    107544156 (IKBKG)
   05163 Human cytomegalovirus infection
    107544156 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107544156 (IKBKG)
   05169 Epstein-Barr virus infection
    107544156 (IKBKG)
   05165 Human papillomavirus infection
    107544156 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107544156 (IKBKG)
   05142 Chagas disease
    107544156 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107544156 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107544156 (IKBKG)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107544156 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 SAM_Exu
Other DBs
NCBI-GeneID: 107544156
NCBI-ProteinID: XP_016077428
LinkDB
Position
Unknown
AA seq 412 aa
MSTPPWKSQLCEMVQPSGGPAGDQDVQGEESSLGKPTMLHLPSEQGAPETFQRCLEENQE
LRDAIRQSNQMLRECCEELQRFQGSQREEKEFLMQKFQEARKLVERLNLEKLDLKRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQTLEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQNQSMEAALRMERQTASEEKRKLAQLQVAYHQLFQD
YDNHIKSSMGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADI
YEADFQAERQAREKLAEKKELLQEQLEQLQREYSRLKTSCQESARIEDMRKRHVEVSQPP
LAPAPAHQSFHSALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIQ
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagcacgcccccctggaagagtcagctgtgtgagatggtgcagcccagtggtggcccg
gctggggaccaggacgtgcagggtgaagaatcttctctggggaagccaaccatgctccac
ctgccttcggagcagggtgctcctgagaccttccagcgctgtctggaggagaatcaagag
ctccgagatgccattcggcagagcaaccagatgctgcgggagtgctgtgaggagctgcag
cgttttcaaggcagccagagggaggagaaggagttcctcatgcagaaattccaagaggcc
aggaaactggtggagagactgaatctggagaagcttgacttgaagaggcagagggagcag
gccctgcaggaggtggagcacctaaagagatgccaacagcagatggctgaggacaaggcc
tcggtgaaagcccaggtgacatccttgctgggggagctccaggagagccagagtcgcttg
gaggctgccaccaaggatcggcagactttggagggcagggcccgggcagccagtgagcaa
gcccggcagctggagagcgagcgggaggcactgcagcagcagcacagcgtgcaggtggac
cagttgcgcatgcagaaccagagcatggaggctgctctgcgcatggagcgccagactgcc
tcagaggagaagcggaagctggcccagctacaggtagcctatcaccagctcttccaagat
tatgacaatcacatcaagagcagcatgggaatgcagctggaagatctcaagcagcagctc
cagcaggccgaggaggccctggtggctaaacaggaagtgatcgacaagctgaaagaagag
gctgagcagcacaagattgtgatggagactgttccagtgctgaaggcccaggcggatatc
tatgaggcagatttccaggctgagagacaggcccgggagaagctggccgagaagaaggag
ctcttgcaggagcagctagagcagctgcagcgggagtatagcaggttgaagaccagctgt
caggagtctgccaggattgaggatatgaggaaacggcatgtagaagtctcccagcccccc
ttggcccctgccccagctcaccagtcctttcactctgccttgcccagccagaggagaagc
cccccggaggagccacctgacttctgttgccccaagtgccagtaccaggcccctgatatg
gacaccctgcagatacatgtcatggagtgcattcagtag

DBGET integrated database retrieval system