KEGG   Miniopterus natalensis: 107523942
Entry
107523942         CDS       T05883                                 

Gene name
CHRNA6
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-6
  KO
K04808  nicotinic acetylcholine receptor alpha-6
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107523942 (CHRNA6)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107523942 (CHRNA6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107523942 (CHRNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107523942 (CHRNA6)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107523942 (CHRNA6)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD CRA
Other DBs
NCBI-GeneID: 107523942
NCBI-ProteinID: XP_016051127
LinkDB
Position
Unknown
AA seq 499 aa
MLTSKGRGCLHFGLCLWLYLFIPFFKDCAGCASEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHVWNDYKLRWDPVEFDGIETIRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYDGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMKDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
LFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVI
PLVGEYLLFTMIFVTLSIAVTVFVLNIHYRTPTTHTMPKWVKTVFLQLLPQILMMKRPLD
KTRKTNSDKNPKSISSRPTKVKFNNCREPKLLRECCHCHESRQLATRKRRLSHQPLQWRA
ENSQHSPEVEDVINSVQLIAENMKNQNEAKEVEDDWKYVAMVVDRVFLWIFIIVCVFGTA
GLFLQPLLGNTGNLKDFIL
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgctgaccagcaagggccggggatgccttcactttggtttgtgtctctggctctatctg
ttcatacctttctttaaagattgcgcaggctgtgcgtctgaggagagactctttcacaaa
ctgttttctcattataaccaattcatcaggcccgtggaaaatgtttctgaccccgtcacg
gtgcattttgaagtggccatcacacagctggccaatgtggatgaagtaaaccagatcatg
gaaaccaatctgtggctacgtcatgtctggaatgattataaattgcgctgggacccagtg
gaatttgatggcatcgagactattcgtgttcctgcagataagatctggaagcctgacatt
gttctttataacaatgctgttggcgacttccaagtcgaaggcaagaccaaagctcttctt
aaatacgatggcatgataacctggactccaccagctattttcaagagttcctgtcctatg
gatatcacttttttcccttttgatcatcaaaattgttccctgaaatttgggtcctggaca
tatgacaaagctgaaattgatcttctaatcattgggtctaaagtggatatgaaagatttt
tgggaaaacagtgaatgggaaattgttgatgcttctggctacaagcatgacataaaatac
aactgttgtgaagagatatacacagatataacctattctttttacattagaagattgcca
ctgttttacaccattaatctgatcatcccctgtctctttatttcatttctaactgtgttg
gtcttttaccttccttctgactgtggtgaaaaagtgacactttgcatttcagttctgctt
tctctcactgtgtttttactggtgatcacagaaaccatcccatccacatctcttgtgatc
ccactggtgggtgagtacttactgttcaccatgatctttgtcaccctttccatcgccgtg
actgtatttgtgttgaacatacactatcggaccccaacaacacacaccatgcccaagtgg
gtgaagacggttttcctccagctgttaccccagatcctgatgatgaagagacccctggac
aagacaaggaagacaaattctgataaaaaccccaaaagcatttccagcaggcctaccaaa
gtcaagttcaataattgcagagaacccaaactacttagagaatgctgccactgccatgaa
tcacgtcagcttgccacccgcaagagaaggctgagtcatcagcctttacaatggagagca
gaaaattcgcagcactcgcctgaagtggaagatgtgattaatagtgttcaactcatagca
gaaaacatgaagaaccaaaatgaagcaaaagaggtagaagatgactggaaatatgtggcc
atggtggtggacagagtatttctctggatatttataattgtctgtgtgtttggaactgca
gggctatttctccagccactcctggggaacacaggaaatcttaaggattttatcttgtga

DBGET integrated database retrieval system