KEGG   Miniopterus natalensis: 107523942
Entry
107523942         CDS       T05883                                 

Gene name
CHRNA6
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-6
  KO
K04808  nicotinic acetylcholine receptor alpha-6
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107523942 (CHRNA6)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107523942 (CHRNA6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107523942 (CHRNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107523942 (CHRNA6)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107523942 (CHRNA6)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD CRA
Other DBs
NCBI-GeneID: 107523942
NCBI-ProteinID: XP_016051127
LinkDB
Position
Unknown
AA seq 499 aa
MLTSKGRGCLHFGLCLWLYLFIPFFKDCAGCASEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHVWNDYKLRWDPVEFDGIETIRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYDGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMKDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
LFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVI
PLVGEYLLFTMIFVTLSIAVTVFVLNIHYRTPTTHTMPKWVKTVFLQLLPQILMMKRPLD
KTRKTNSDKNPKSISSRPTKVKFNNCREPKLLRECCHCHESRQLATRKRRLSHQPLQWRA
ENSQHSPEVEDVINSVQLIAENMKNQNEAKEVEDDWKYVAMVVDRVFLWIFIIVCVFGTA
GLFLQPLLGNTGNLKDFIL
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgctgaccagcaagggccggggatgccttcactttggtttgtgtctctggctctatctg
ttcatacctttctttaaagattgcgcaggctgtgcgtctgaggagagactctttcacaaa
ctgttttctcattataaccaattcatcaggcccgtggaaaatgtttctgaccccgtcacg
gtgcattttgaagtggccatcacacagctggccaatgtggatgaagtaaaccagatcatg
gaaaccaatctgtggctacgtcatgtctggaatgattataaattgcgctgggacccagtg
gaatttgatggcatcgagactattcgtgttcctgcagataagatctggaagcctgacatt
gttctttataacaatgctgttggcgacttccaagtcgaaggcaagaccaaagctcttctt
aaatacgatggcatgataacctggactccaccagctattttcaagagttcctgtcctatg
gatatcacttttttcccttttgatcatcaaaattgttccctgaaatttgggtcctggaca
tatgacaaagctgaaattgatcttctaatcattgggtctaaagtggatatgaaagatttt
tgggaaaacagtgaatgggaaattgttgatgcttctggctacaagcatgacataaaatac
aactgttgtgaagagatatacacagatataacctattctttttacattagaagattgcca
ctgttttacaccattaatctgatcatcccctgtctctttatttcatttctaactgtgttg
gtcttttaccttccttctgactgtggtgaaaaagtgacactttgcatttcagttctgctt
tctctcactgtgtttttactggtgatcacagaaaccatcccatccacatctcttgtgatc
ccactggtgggtgagtacttactgttcaccatgatctttgtcaccctttccatcgccgtg
actgtatttgtgttgaacatacactatcggaccccaacaacacacaccatgcccaagtgg
gtgaagacggttttcctccagctgttaccccagatcctgatgatgaagagacccctggac
aagacaaggaagacaaattctgataaaaaccccaaaagcatttccagcaggcctaccaaa
gtcaagttcaataattgcagagaacccaaactacttagagaatgctgccactgccatgaa
tcacgtcagcttgccacccgcaagagaaggctgagtcatcagcctttacaatggagagca
gaaaattcgcagcactcgcctgaagtggaagatgtgattaatagtgttcaactcatagca
gaaaacatgaagaaccaaaatgaagcaaaagaggtagaagatgactggaaatatgtggcc
atggtggtggacagagtatttctctggatatttataattgtctgtgtgtttggaactgca
gggctatttctccagccactcctggggaacacaggaaatcttaaggattttatcttgtga

KEGG   Miniopterus natalensis: 107527910
Entry
107527910         CDS       T05883                                 

Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-7
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05033  Nicotine addiction
mna05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107527910
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527910
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107527910
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107527910
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107527910
   05022 Pathways of neurodegeneration - multiple diseases
    107527910
  09165 Substance dependence
   05033 Nicotine addiction
    107527910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527910
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107527910
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107527910
NCBI-ProteinID: XP_016056296
LinkDB
Position
Unknown
AA seq 349 aa
MRRSVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIM
DVDEKNQVLTTNIWLQMSWTDHYLQWNTSEYPGVKTVRFPDGQIWKPDILLYNSADERFD
ATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQ
EADISGYIPNGEWDLMGIPGKRSEKFYECCKEPYPDVTFTVTIRRRTLYYGLNLLIPCVL
ISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMII
VGLSVVVTVIVLQYHHHDPDGGQMPKWVRSSRPPCSGSGALPKGGAMNG
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcgccgctcggtctggctggcgctggcggcgtcgctcctgcacgtgtccctgcaaggc
gagttccagaggaagctctacaaggagctggtcaagaactacaaccccttggagaggccc
gtggccaacgactcgcagccgctcaccgtctacttctccctgagtctcctgcagatcatg
gacgtggacgagaagaaccaagttctaaccaccaacatctggctgcagatgtcctggaca
gatcactacctgcagtggaacacatcggagtacccgggcgtgaagactgtgcgctttccg
gacgggcagatctggaagccagacattcttctgtacaacagtgccgatgagcgatttgat
gccaccttccacaccaacgtgttagtgaattcttccgggcattgccagtacctccctcca
ggcatattcaagagctcctgctacatcgatgtgcgctggttcccttttgacgtgcagcag
tgcaagctgaagtttggatcctggtcctacggaggctggtccttggatctgcagatgcag
gaggcggatatcagtggctacatccccaacggagaatgggacctcatgggaatcccgggc
aagcgcagtgagaagttctatgagtgctgtaaggagccctaccccgacgtcaccttcaca
gtgaccatccgccgcaggaccctctactacggcctcaacctcctcatcccctgcgtgctc
atctctgccctggccctgctggtcttcctgctccccgcagactctggagagaaaatctcc
ctcgggataactgttttgctctctctcaccgtgttcatgcttctggtggccgagatcatg
cctgcaacatccgactcagtgcccttgatagcccagtacttcgccagcaccatgatcatc
gtgggcctctccgtggtcgtcacggtgattgtgctgcagtaccaccaccacgaccctgac
ggcggccagatgcccaagtgggtgcgttcctcccgccctccctgcagcgggtcaggggcc
ctccccaaaggaggcgccatgaatgggtga

KEGG   Miniopterus natalensis: 107529071
Entry
107529071         CDS       T05883                                 

Gene name
CHRNA4
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-4 isoform X1
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107529071 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107529071 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107529071 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107529071 (CHRNA4)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107529071 (CHRNA4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 107529071
NCBI-ProteinID: XP_016057841
LinkDB
Position
Unknown
AA seq 629 aa
MELGQGRAGRLPRLEPARCTMELGRPGMKPLLQLLLLLGASLLPVSGHMEARVHAEERLL
KKLFSGYNKWSRPVANISDVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWD
PRDYENLTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVRWTPPAIYKSSC
SIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHRRVDQLDFWESGEWVIVEAVGTYNTR
KYECCAEVYPDITYAFVIRRLPLFYSVNLLAPCLLVSGLAVLVFYLPSECGEKVTLCISV
LLALTVFLLLITEIVPATSLVIPLIGEYLLFTMTFVTLSIVVTVFALNVHHRSPRTHSMP
AWVRRVFLDVAPRLLLMKRPSVVKNNCRRLLESMHKVASAPHFWPDPEGEPSFENRAQSR
GPSPTLSVCGPCQAPVRPQPPRTSPSGQEAKEASPCPSPSPCRPPTSTWAPGLTKTRSLS
VQHMSSPSKTAEGSVRCRSQSIQYCVPQDKAASRANGPTAGSLPSLRASWAELQASPHKC
KCKEPSTGSLNTAFKACNHLPLSPAVAQAVKGVQYIADHLKAEDIDFLVKEDWKYVAMVI
DRIFLWVFVIVCLLGTAGLFLPPWLAGMI
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggagctggggcaaggccgagccgggagactcccgcgactagagcctgctcgctgcacc
atggagctcgggcgcccggggatgaagccgctgctgcagctgctgctgcttctgggggcc
agcctcctgcccgtgagcggccacatggaggctcgggtccatgcagaggagcgcctgctg
aagaaactcttctctggctacaacaagtggtcccggccagtggccaacatctcggacgtg
gtccttgtccactttggcctgtccattgcacagctcattgatgtggatgagaagaatcag
atgatgacaacgaatgtgtgggtgaagcaggagtggcatgactataagctgcgctgggac
cccagagactacgagaacttaacttccatcagaatcccctccgagctcatctggcggccg
gacattgtcctctacaacaatgcggatggggacttcgctgtcacccacctgaccaaggcc
cacttgttccacgacgggcgggtgcggtggacgccgcccgccatctacaagagctcctgc
agcatcgacgtcaccttcttccccttcgaccagcagaactgcaccatgaagttcgggtcc
tggacgtacgacaaggccaagatcgacctggtgagcatgcaccgccgcgtggaccagctg
gacttctgggagagcggcgagtgggtcatcgtggaggccgtgggcacctacaacaccagg
aagtacgagtgctgcgcggaggtgtaccccgacatcacctacgccttcgtcatccggcgc
ctgcccctcttctacagcgtcaacctgctggccccctgcctgctcgtctccggcctggcc
gtgctggtcttctacctgccctctgagtgcggcgagaaggtcacgctgtgcatctccgtg
ctgctggcgctcaccgtcttcctgctgctcatcaccgagatcgtgcccgccacctccctg
gtcatcccgctcatcggcgagtacctgctcttcaccatgaccttcgtcaccctgtccatc
gtcgtcaccgtcttcgcgctcaacgtgcaccaccgctccccgcgcacgcactctatgccc
gcctgggtgcgccgcgtcttcctggacgttgcgccgcgtctgctcctcatgaagcggccg
tctgtggtcaagaacaactgccggcggctcctcgagtccatgcacaaggtggccagcgcc
ccacacttctggcccgaccccgagggggagcccagcttcgagaacagagcccagagccgg
ggcccctcacccaccctgtccgtctgtggtccctgccaagcgccagtcaggccccagccg
ccccgcacgtcaccctcaggccaggaggccaaggaagccagcccctgcccctcacccagc
ccctgccgcccacccaccagcacctgggccccagggctcaccaaaacccggtccctgagt
gtccagcatatgtccagccccagcaaaacagcagagggcagcgtccggtgccggtctcag
agcatccagtactgcgttccccaagacaaggctgcctcccgggccaacggccccacagct
ggctcccttccctccctgagggcttcctgggccgagctccaggcctctccccacaaatgc
aagtgcaaggagccatccactgggtccctaaatactgcgttcaaagcctgcaatcacctg
cccctgtcgcccgccgtggcgcaggctgtcaagggtgtccagtacatcgcagatcaccta
aaggcagaagacatagacttcttggtgaaggaggactggaagtacgtggccatggtcatc
gaccggatcttcctctgggtgttcgtcatcgtctgcttgctggggacagccggcctcttc
ctgccaccctggctggccggcatgatctag

KEGG   Miniopterus natalensis: 107534467
Entry
107534467         CDS       T05883                                 

Gene name
CHRNA3
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-3
  KO
K04805  nicotinic acetylcholine receptor alpha-3
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107534467 (CHRNA3)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107534467 (CHRNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107534467 (CHRNA3)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107534467 (CHRNA3)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD FlgN
Other DBs
NCBI-GeneID: 107534467
NCBI-ProteinID: XP_016065061
LinkDB
Position
Unknown
AA seq 497 aa
MGAHSHRGHPILLLLQLISVASGSEAEHRLFERLFEDYNEIIRPVANVSDAVIVQFEVSM
SQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYDGAEFLRVPAQKIWKPDIVLYNNAV
GDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKID
LVLIGSSMNLKDYWESGEWAIIRAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINL
IIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYL
LFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVRTLFLNLLPRVMFMTRPAGNEGSAPR
PRPVCSGELSNLNCFSRVGSKGCKEGHPCQDVLCGYCHHHRRKVSNFTANLTRSSSTESV
DAVLSFSALSPEVKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFILVCI
LGTAGLFLQPLMARDET
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgggcgcacactcgcaccggggtcacccaattctgctgctgctgcagctgatatcagtg
gccagcggctccgaggctgagcaccgtctgtttgagcggctgtttgaagattacaatgag
atcatccggcctgtggccaacgtgtcagacgctgtcatcgtccagtttgaggtgtccatg
tctcaactggtgaaggtggatgaagtaaaccagatcatggagaccaacctgtggctcaag
caaatctggaatgactacaagctgaagtggaacccctctgactacgacggggcggagttc
ctgcgtgtccctgcacagaagatctggaagcctgatatcgtcctctacaacaacgcagtg
ggggatttccaggtggatgacaagaccaaggctttgctcaagtacacgggcgaagtgact
tggatccctccggccatctttaagagctcgtgcaaaatcgacgtgacctacttcccgttt
gattaccagaactgcaccatgaagttcgggtcctggtcctacgacaaggcaaaaatcgac
ctggtcctcatcggctcctccatgaacctcaaggactactgggagagcggcgagtgggcc
atcatccgagccccgggctacaagcacgacatcaagtacaactgctgcgaggagatctac
cccgacatcacgtactcgctgtacatccggcgcctgccgctcttctacaccatcaacctc
atcataccctgtctgctcatctccttcctcacggtgctcgtcttctacctgccctcggac
tgtggcgagaaggtgaccctctgcatctccgtgctcctgtccttgaccgtctttctgctg
gtgatcacggagaccatcccatccacctccctggtcatccccctgatcggcgagtacctc
ctgttcaccatgattttcgtcaccttgtccatcgtcatcaccgtcttcgtgctcaacgtg
cactacagaacccccaccacgcacacgatgcccacgtgggtgaggaccctgttcttgaac
ttgcttcccagggtcatgttcatgaccaggccggcaggcaatgaaggcagtgccccgagg
cccagacccgtgtgcagtggtgagctctccaacctgaactgcttcagccgggtggggtcc
aaaggctgcaaggaaggccacccctgccaggacgtgctgtgcggctactgccaccaccac
aggaggaaagtctcaaacttcaccgccaacctcacgagaagctccagcactgaatctgtg
gacgccgtgctctcgttttctgctttgtcgccggaagtcaaagaagccatccagagtgtc
aagtatattgctgaaaatatgaaagcacaaaatgaagccaaagagattcaagatgactgg
aagtatgtggccatggtgattgatcgtattttcctgtgggttttcatcctggtgtgcatt
ttagggacggccgggttgtttctgcagcccttgatggccagggatgaaacctaa

KEGG   Miniopterus natalensis: 107534468
Entry
107534468         CDS       T05883                                 

Gene name
CHRNB4
Definition
(RefSeq) neuronal acetylcholine receptor subunit beta-4
  KO
K04815  nicotinic acetylcholine receptor beta-4
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107534468 (CHRNB4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107534468 (CHRNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107534468 (CHRNB4)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107534468 (CHRNB4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 107534468
NCBI-ProteinID: XP_016065064
LinkDB
Position
Unknown
AA seq 491 aa
MRGAHPLVLFSLAALCGRGDCRVANAEERLMDDLLNKTRYNKLIRPAASSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLAWNSSRYEGVKILRIPAKRIWLPDIVLYNN
ADGTYEVSLYTNAVVRANGSVMWIPPAICKSACKIEVKHFPFDQQNCSLKFRSWTYDHTE
IDMVLKSPTASMDDFTPSGEWDIMALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINII
IPCVLITSLAVLVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVQRCFLHQLPTFLFMKRPDSNPVRAPQP
SQSEATAATTVAKGPASSSNLYGSSMYFMNSASAAPKSPAGSDLVGIPRDFRLRSSGRFQ
QDVQEALDGVSFIAQHMKSDDQDQSVVEDWKYVAMVVDRLFLWVFVVVCVLGTVGLFLPP
LFQNHTTSGGP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaggggcgcgcaccccctggttcttttctccctggctgccctttgcgggcgcggggac
tgccgcgtggccaacgccgaggagaggctcatggatgaccttctgaacaaaacccgctac
aacaagctgatccgcccggccgccagctcctcacagctcatctccatcaagctgcagctc
tccctggcccagcttatcagcgtgaatgaacgagaacagatcatgacaaccaatgtctgg
ctgaaacaggaatggaccgactaccgcctggcctggaacagctcccgctacgagggcgtg
aagatcctgaggatccctgcaaagcgcatctggctgccggacatcgtgctttacaacaat
gccgatgggacctacgaggtgtctctctacaccaacgcggtggtgcgggccaatggcagc
gtcatgtggatacccccggccatctgcaagagcgcctgcaagattgaggtgaagcatttc
ccctttgatcagcagaactgcagcctcaagttccgctcctggacctacgaccacacagag
atcgacatggtcctcaagtcacccactgccagcatggatgacttcacccccagtggagaa
tgggacatcatggccctcccggggcggaggacagtgaacccccaggaccccagctacgtg
gacgtgacgtacgacttcatcatcaagcgcaagccactcttctacaccatcaacatcata
attccctgcgtgctcatcacctcgctggccgtccttgtcttctacctgccatccgactgc
ggcgagaagatgacactgtgcatctctgtgctgctggcgctcaccgtcttcctgctgctc
atctccaagatcgtgccacccacctccctggatgtgccactcatcggcaagtacctcatg
ttcaccatggtgcttgtcaccttctccatcgtcaccagcgtgtgcgtgctcaacgtgcac
caccgctcacccagcacccacaccatggcgccctgggtccagcgctgcttcctacaccag
ctgcccaccttcctcttcatgaagcggcctgacagcaaccctgtaagggccccacagccc
agccagtccgaggccaccgctgccaccaccgtggccaagggccctgccagctcctccaat
ctctatgggagctccatgtactttatgaattctgcctctgcagctcccaagtctcccgca
ggctccgacttggtggggatccccagggatttccggctgagatcttctgggaggttccag
caggacgtgcaggaggctttggacggcgtcagcttcatcgcccagcacatgaagagtgac
gatcaggaccagagcgtcgtggaggactggaagtacgtggccatggtggtcgaccgactg
ttcctgtgggtgtttgtggtcgtgtgcgtgctgggcaccgtgggactcttcctgcctccg
ctcttccagaaccacacaacttctggggggccctag

KEGG   Miniopterus natalensis: 107543725
Entry
107543725         CDS       T05883                                 

Gene name
CHRNB2
Definition
(RefSeq) neuronal acetylcholine receptor subunit beta-2
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107543725 (CHRNB2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107543725 (CHRNB2)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107543725 (CHRNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107543725 (CHRNB2)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107543725 (CHRNB2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb PHO4
Other DBs
NCBI-GeneID: 107543725
NCBI-ProteinID: XP_016076801
LinkDB
Position
Unknown
AA seq 349 aa
AFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHE
REQIMTTNVWLTQEWEDYRLSWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFY
SNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVA
SLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIKRKPLFYTINLIIPCVLITSLA
ILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVSEDWKY
VAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTATFLHADHPAPSSK
NT seq 1050 nt   +upstreamnt  +downstreamnt
gccttcggcctcctccggctgtgctcaggagtctggggcacagacacagaggagcggctg
gtggagcatctcctggatccttcccgctacaacaagcttatccgcccagccaccaatggc
tctgagctggtgacggtacagctcatggtatcactggcccagctcatcagtgtgcatgag
cgggagcagatcatgaccactaatgtctggctgacccaggaatgggaagattatcgcctc
agttggaagcctgaggagttcgacaacatgaagaaagttcgactcccttccaaacacatc
tggctcccagatgtggtcctatacaacaatgctgatggcatgtacgaggtgtccttctat
tccaacgccgtggtctcctatgacggcagcatcttctggctgccccccgccatctacaag
agcgcctgcaagatcgaagtaaagcacttcccctttgaccagcagaactgtaccatgaag
ttccgctcctggacctacgaccgcaccgagatcgacctggtgctgaagagcgacgtggcc
agcctggacgacttcacgcccagcggcgagtgggacatcgtggcgctgccgggccggcgc
aacgagaaccccgacgactccacgtacgtggacatcacctacgacttcatcatcaagcgc
aagccgctcttctacaccatcaacctcatcattccctgcgtgctcatcacctcgctggcc
atcctggtcttctacctgccgtccgactgcggcgagaagatgacgctgtgcatctccgtg
ctgctggcgctcaccgtcttcctgctgctcatctccaagatcgtgccgcccacgtccctc
gacgtgccgctggtgggcaagtacctcatgttcaccatggtgagtgaagactggaagtat
gtcgccatggtgatcgaccgcctgttcctttggatctttgtctttgtctgtgtctttggc
accatcgggatgttcctacagcctctcttccagaactacaccaccgccaccttcctccat
gcagaccacccggctcccagctccaagtga

DBGET integrated database retrieval system