KEGG   Miniopterus natalensis: 107523981
Entry
107523981         CDS       T05883                                 

Gene name
ABCB11
Definition
(RefSeq) bile salt export pump
  KO
K05664  ATP-binding cassette, subfamily B (MDR/TAP), member 11
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna02010  ABC transporters
mna04976  Bile secretion
mna04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107523981 (ABCB11)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107523981 (ABCB11)
   04979 Cholesterol metabolism
    107523981 (ABCB11)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107523981 (ABCB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107523981 (ABCB11)
   04147 Exosome [BR:mna04147]
    107523981 (ABCB11)
Transporters [BR:mna02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB11 subgroup
    107523981 (ABCB11)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107523981 (ABCB11)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase ABC_ATPase AAA_22 Zeta_toxin AAA_15 AAA_29 AAA_30 DUF87 Rad17 AAA_21
Other DBs
NCBI-GeneID: 107523981
NCBI-ProteinID: XP_016051189
LinkDB
Position
Unknown
AA seq 1325 aa
MPDSVILRSVKKLGEENHCFEPDGPYNNDKNSRLQNEKKGDRSQVGFFQLFRFSSTTDIW
LMFVGGLCAFLHGLAHPGVLLIFGTMTDVFINYETELQELQIPGKACVNNTIVWTNSSLN
QNVTNGMPCGLLDIESEMIKFASYYAGTAVAVLITGYIQICFWVISSARQIQKMRKLYFR
KIMRMEIGWFDCNSVGELNTRFSDDINKINDAIADQMAIFIQRMTTSICGFLLGFYQGWK
LTLVIISVSPLIGLGAAIIGLSVSTFTDHELKAYARAGSVADEVISSIRTVAAFGGEKKE
VERYEKNLVFAQRWGIRKGIVMGFFTGFMWCLIFLCYALAFWYGSKLVLDEGEYTAGVLV
QIFLSVIVGALNLGNASSCLEAFATGRAAATSIFETIDQTPVIDCMSEDGYKLDRIKGEI
EFHNVTFHYPSRPEVKILKNLSMVIKPGEMTAVVGSSGAGKSTALQLIQRFYDPSEGMVT
LDGHDIRSLNIQWLRAQIGIVEQEPVLFSTTIAENIRYGREEATMEDIVRAAKEANAYNF
IMELPQQFDTLVGEGGGQMSGGQKQRVAIARALVRNPKILLLDMATSALDNESEAMVQEA
LSKIQHAHTIISVAHRLSTVRAADVIIGFEHGAAVEKGTHEELLERKGVYFTLVTLQSQG
EQAFNEEDVKGKDDTEGALLESRQTFSRGSYQASLRASIRQRSKTQLSYLVHEPSFTAAD
HKPTYEQDRKDKSILVEEEVEPAPVRRILKLNAPEWPYMVVGSVGAAVNGAVTPLYAFLF
SQILGTFSLPDKEEQRSQINGVCLLFVAMGCASLCTQFLQGYAFAKSGELLTKRLRKFGF
RAILGQDIGWFDDLRNSPGALTTRLATDASQVQGAAGSQIGMIVNSFTNIVVAMIIAFFC
SWKLSLVIVCFLPFLALSGAVQTKMLTGFASQDKQALETAGQVASEALSNIRTIAGIGKE
RQFIEAFERELVKPFKTAIRKANVYGFCFGFSQCIVFVANSASYRYGGYLIYNEGLHFSY
VFRVISSVILSGTALGKAYSYTPSYAKAKISAARFFQLLDRQPPINVYSGAGEKWDNFQG
QIDFIDCKFTYPSRPDVQVLNGLSVSVSPGQTLAFVGSSGCGKSTSVQLLERFYDPDQGK
VIIDGHDSKKVNVQFLRSKIGIVSQEPVLFACSITDNIKYGDNTKDIPMEKVIQAAKQAQ
LHDFVMSLPEKYDTNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKT
VQVALDKAREGRTCIVIAHRLSTIQNSNIIAVMSQGAVIEKGTHKELMAQKGAYYKLVTT
GAPIS
NT seq 3978 nt   +upstreamnt  +downstreamnt
atgcctgactcagtgattctccgcagcgtgaagaagcttggagaggagaaccactgcttt
gagccagatggaccatataacaatgataagaattcacggttacaaaatgagaagaaaggt
gacagaagtcaagttggcttctttcaattgtttcggttttcttcaacgactgacatttgg
ctgatgtttgtgggaggtttatgtgcatttctccacggactagcccatccaggcgtgtta
ctcatttttggcaccatgacagatgtttttattaactacgaaactgaattacaagaactg
cagatccctggaaaagcatgtgtaaataacaccatagtgtggaccaacagctccctcaac
cagaacgtaacaaatggaatgccttgtgggttgctggacattgaaagtgaaatgatcaaa
tttgccagttactacgctggaactgctgtggcggttcttatcacaggatatattcaaata
tgcttctgggtaatttcttcagctcgtcagatacagaaaatgagaaaattgtactttagg
aaaataatgagaatggaaataggatggttcgactgcaattcagtgggagagttgaataca
agattttctgatgatattaataaaatcaatgatgccattgctgaccaaatggccattttc
attcagcgcatgaccacgagcatctgcgggttcctgctgggattttaccaggggtggaag
ctgaccttggttatcatctccgtgagccctctcattggcttgggagcagccatcatcggc
ctgagtgtgtccacgttcactgaccatgaactgaaggcctatgccagagcagggtcggtg
gctgatgaagtcatttcatccattcgaacggtggctgcttttggtggtgagaaaaaagag
gttgaaaggtatgagaaaaatcttgtgtttgcccaacgttggggcattagaaaagggata
gtgatgggattcttcactggcttcatgtggtgtctcatcttcctgtgttatgcactggcc
ttctggtacggctccaaactcgtcctggatgagggagaatatacagcaggagtccttgtc
cagattttcctcagtgtcatagtgggagctttaaatcttggcaacgcatcttcttgtttg
gaagcctttgcaactggacgtgcagcagccaccagcatttttgagacaatagaccagaca
cctgttattgactgcatgtcagaagatggttacaagctggatcgaattaaaggtgaaatt
gaattccataatgtgaccttccactatccttccaggccagaggtgaagattctaaagaac
ctcagcatggtcatcaaaccgggggaaatgacggctgtggtaggatccagtggagctggg
aagagcacagccctgcagctcattcagcgattctacgaccccagtgaaggcatggtgact
ttggatggccatgacattcgctctcttaacattcagtggcttagagctcagattggaatt
gtggagcaagagcctgttctgttctccaccaccatcgcagagaatattcgctatggcaga
gaagaggcgacgatggaagatattgtccgagcggccaaggaagccaatgcctacaacttc
atcatggagctgccacagcaatttgacactcttgttggagaaggaggaggccagatgagt
ggcggccagaaacaaagggtagccattgctagagccctcgtccgaaatcccaagatcctg
cttttggacatggccacctcggcactggacaacgagagcgaagccatggtgcaggaggca
ctgagtaagattcagcacgcgcatacgatcatttcagtggcccatcgactgtccacggtc
agagctgcagatgtcattattggttttgaacacggtgcagcagtggagaaaggcacccat
gaagaactgttggaaagaaaaggcgtttacttcactctagtgactttgcaaagtcaagga
gagcaagcctttaatgaagaagacgtaaagggaaaggatgacactgaaggtgctttactt
gagagcagacagacctttagcagagggagctaccaggctagtttaagagcttccatcagg
caacgctccaagactcagctttcttacctggtacacgaaccttcatttactgctgcagat
cataaacctacttatgaacaagacagaaaggacaagagcattctcgtggaagaagaagtg
gaacctgcccccgtcaggcggattctgaaactcaatgctccagaatggccctacatggtg
gtcggctctgtgggcgcagctgtcaatggggcagtcacacccctctatgcctttttattc
agccagattcttgggactttttcacttcctgataaagaagaacaaaggtcacagatcaat
ggtgtgtgcctgctttttgtagcaatgggttgtgcatccctttgcactcaatttctgcag
ggatatgcttttgctaagtccggagaactcctcacaaaaaggctacgtaaatttggtttt
agagcaatattagggcaagacattggctggtttgatgacctcagaaatagccctggagca
ctgacgaccaggcttgctacagatgcctcccaagttcaaggggctgccggctctcagatc
gggatgatagtcaattccttcactaacatcgttgtggccatgatcattgccttcttctgt
agctggaagctcagcctggtcatagtgtgtttcctccctttcttggctctgtcgggagct
gtgcagaccaaaatgctgacaggatttgcctctcaagacaagcaggccctggagactgca
ggacaggttgcaagtgaagccctcagcaatatccgcactattgctggaattggaaaggag
aggcagtttattgaagcatttgagagggagctggtgaagccattcaagacagccattcga
aaagcaaatgtttatggattctgctttggtttttcccagtgcattgtgtttgttgctaat
tctgcttcctacagatatggaggttacttaatctacaatgaggggctccatttcagctat
gtgttcagggtgatctcttcagttattctgagtgggacagctcttggaaaagcctactct
tacaccccgagttatgccaaagctaagatatcagctgcacgcttttttcaactgctggac
cgacaacccccaatcaatgtatacagtggggcaggtgaaaagtgggacaacttccagggg
cagattgactttattgactgtaaatttacgtatccttctcgacctgatgtgcaagttctt
aatggtctctccgtgtcggttagtccagggcaaacgctggcatttgttggaagcagcgga
tgtggcaaaagcaccagtgttcagctgttggaacgtttctatgatcctgaccaagggaag
gtgataatagatgggcatgacagcaaaaaggtaaatgtccagtttctccgctcgaagatt
ggaattgtttcccaggagccggtgttgtttgcctgtagcataacggacaatatcaagtat
ggggacaacaccaaagacattcccatggaaaaagtcatacaagctgcaaagcaggctcag
ctgcatgactttgtcatgtcactcccggagaaatatgatactaatgttgggtcccagggg
tctcaactctctcgaggagagaaacaacgcattgctattgctcgggccattgtgcgagat
cctaaaatcttgctactagatgaagctacttctgctttagacacagaaagtgaaaagaca
gtgcaggttgccttggacaaagccagagaaggccggacatgcattgtcattgcccaccgt
ctgtccaccattcagaactcgaatatcattgctgtcatgtcacagggggcagtgattgaa
aaggggacccataaagaactgatggcccagaaaggagcctactacaaactagtcaccaca
ggagcccccatcagttga

DBGET integrated database retrieval system