KEGG   Miniopterus natalensis: 107524046
Entry
107524046         CDS       T05883                                 

Gene name
MITF
Definition
(RefSeq) microphthalmia-associated transcription factor
  KO
K09455  microphthalmia-associated transcription factor
Organism
mna  Miniopterus natalensis
Pathway
mna04137  Mitophagy - animal
mna04380  Osteoclast differentiation
mna04916  Melanogenesis
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05218  Melanoma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107524046 (MITF)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107524046 (MITF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107524046 (MITF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524046 (MITF)
   05202 Transcriptional misregulation in cancer
    107524046 (MITF)
  09162 Cancer: specific types
   05218 Melanoma
    107524046 (MITF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107524046 (MITF)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    107524046 (MITF)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH RNA_pol_Rpb4
Other DBs
NCBI-GeneID: 107524046
NCBI-ProteinID: XP_016051264
LinkDB
Position
Unknown
AA seq 585 aa
MALGANGVPQSDRAGRIPEWAVLGARRWERAPERRPQPRLRRARGGAGSRDCLEGTRAWR
VSYTRVASVEMESSVAAHSEEHPGASKPPISSSSMTSRILLRQQLMREQMQEQERREQQQ
KLQAAQFMQQRVPVSQTPAINVSVPTSLPSATQVPMEVLKLKQELCELTNNSTVFSSLRG
YVQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPHQPGDHVMPPVPGS
SAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESECPTMTTQSRASCMQMDDVIDDIISLES
SYNEEILSLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTVSNSCPANLPNIKRELTES
EVRALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYI
RKLQREQQRAKELETRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSADLVTRI
IKQEPSLENCSQDILQHHPDLTCTTTLDLTDGTISFNSSLGPGAESSHAYSAPSKMGSKL
EDILMDDTLSPSGVTDPLLSSVSPGASKASSRRSSMSMEEPEHAC
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggcactaggagcgaatggggttccacagtcggacagagcggggagaattcccgagtgg
gctgtgctgggcgcacgccgatgggaaagagcgccggagcggcggccgcagcctcgcctg
cgccgggcccgcggaggcgctggctctcgagactgtcttgaagggactcgagcgtggagg
gtcagctacaccagagtggcatctgtggaaatggagagcagcgtggccgcacattccgag
gagcatcctggggcctccaagcctccgataagctcctccagtatgacatcacgcatcttg
ctacgccagcaactcatgcgtgagcagatgcaggagcaggagcgcagggagcagcagcag
aagctgcaggcggcccagttcatgcaacagcgagtgcctgtgagtcagaccccagccata
aacgtcagcgtgcccacctcccttccctccgccacccaggtgccgatggaagtccttaag
ctaaaacaagagctgtgcgaactcacaaataacagcactgtcttctcttccctccgtggc
tatgttcaggtgcagacccacctcgaaaaccccaccaagtaccacatacagcaagcccag
aggcagcaggtaaagcagtacctttctaccactttagcaaataaacatgccaaccaagtc
ctgagcttgccatgtccacaccagcctggcgaccatgtcatgccaccggtgccggggagc
agcgcacccaacagccccatggccatgctcacacttaactccaactgtgaaaaagaggga
ttttataagtttgaagagcaaaacagggcggagagtgaatgcccaacaatgaccacgcag
tcccgagcgtcctgcatgcagatggatgatgttatcgatgacatcattagcctagaatca
agttataacgaagaaatcctgagcttgatggatcctgccttgcaaatggcaaatacgcta
cctgtctcgggaaacctgattgacctttatggaaatcaaggactgcctccccctggcctc
accgtcagcaactcctgcccagccaacctccccaacatcaaaagggagctcacagagtct
gaggtgagggcgctggccaaagagaggcagaagaaggacaaccacaacctgatcgaacga
agaagaagatttaacataaatgaccgcattaaagagctgggcactctgattcccaagtcc
aatgacccggacatgcgctggaacaagggcaccattttgaaggcgtctgtggactacatc
cgaaagctgcagcgggagcagcagcgcgccaaggagctggagacgcggcagaagaagctg
gagcacgcgaaccggcacctgctgctcaggatccaggaacttgaaatgcaggctcgagct
catggactctcccttattccatccacgggcctctgctctgcagatttggtgactcggatc
atcaagcaagaaccgtccctggagaactgcagccaggacatcctccagcatcacccagac
ctaacttgtacaaccaccctcgatctcacagatggcaccatcagcttcaacagcagcctc
gggcccggggccgagagcagccacgcctacagcgccccctcgaaaatgggctctaagctg
gaagacatcctgatggacgataccctctctccttccggcgtgactgacccgctcctctcg
tcagtgtccccgggagcttccaaagccagcagccggaggagcagcatgagcatggaggag
cccgagcacgcctgctag

DBGET integrated database retrieval system