KEGG   Miniopterus natalensis: 107524098
Entry
107524098         CDS       T05883                                 

Gene name
PPP2R2C
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04390  Hippo signaling pathway
mna04530  Tight junction
mna04728  Dopaminergic synapse
mna05142  Chagas disease
mna05160  Hepatitis C
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107524098 (PPP2R2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107524098 (PPP2R2C)
   04071 Sphingolipid signaling pathway
    107524098 (PPP2R2C)
   04151 PI3K-Akt signaling pathway
    107524098 (PPP2R2C)
   04152 AMPK signaling pathway
    107524098 (PPP2R2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107524098 (PPP2R2C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107524098 (PPP2R2C)
  09156 Nervous system
   04728 Dopaminergic synapse
    107524098 (PPP2R2C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107524098 (PPP2R2C)
   05165 Human papillomavirus infection
    107524098 (PPP2R2C)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107524098 (PPP2R2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107524098 (PPP2R2C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107524098 (PPP2R2C)
   03036 Chromosome and associated proteins [BR:mna03036]
    107524098 (PPP2R2C)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107524098 (PPP2R2C)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107524098 (PPP2R2C)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107524098 (PPP2R2C)
SSDB
Other DBs
NCBI-GeneID: 107524098
NCBI-ProteinID: XP_016051351
LinkDB
Position
Unknown
AA seq 605 aa
MALSGGKNRETTLKLHCGTRAATEAQGQAMSESGAATQPGSQSKDDKDQSCSHLVMGTWH
ERDVDYNRTEVLSGRAPEPRLDSEVVVVQEGAGPPDPPPGWNGRVEPPGRLGPPEGGVSV
SGSLRAACGGAARLLGREEGERYRRGLGPGGPPKARRSVWVLDFLRGDCEGALPSCLSPP
PADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDY
LKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDL
STVTSLQVPVLKPMDLMVEVSPRRVFANGHTYHINSISINSDCETYMSADDLRINLWHLA
ITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHS
KLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRDYLTVKVWDLNMEARPIETYQVH
DYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNNFFRMFDRNTKRDVTLEASRESS
KPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAWHPAENIIAIAATNNLYIFQDKV
NSEMH
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggccctcagtggcggaaagaaccgagagaccactttgaagctccactgcgggacccgg
gcagccactgaggcgcaaggccaagccatgtccgagtctggggctgctacacagcctggc
tcccagagcaaagatgacaaggaccagagctgcagccacctcgtgatgggcacgtggcat
gagcgggatgtagactataaccgaactgaggtcctgagtggccgagcaccagagccgagg
ctggacagcgaggtggtggtggtccaggagggagccgggccccctgaccccccccccggg
tggaatggcagagtggagccccccgggaggctggggcctcctgagggcggggtctccgtg
tctggttcgctccgggccgcgtgtggaggtgcagcgcgtctgctgggacgggaggaggga
gagcgttaccggcggggtctgggcccggggggtccgcctaaggcccgccgcagtgtgtgg
gtgcttgacttcctgcggggtgattgtgagggagccctgccttcctgtctctcccctccc
ccagccgatatcatctctactgtggagttcaaccacacgggagagctgctggccacaggc
gacaagggtggccgggtcgtcatcttccagcgggaaccagagagtaagaatgcgccccac
agccagggcgagtacgacgtctacagcaccttccagagccacgagcccgagtttgattat
ctcaagagcctggagatagaggagaagatcaacaagatcaaatggctcccgcagcagaac
gccgctcactccctgctgtccaccaacgataaaactatcaagttgtggaagatcacggaa
cgagataagaggcctgagggctataacctgaaagacgaagaagggaagctcaaggacctg
tccacggtgacgtcgctgcaggtgcccgtgctgaagcccatggacctgatggtggaggta
agcccacggagggtctttgccaatggccacacctaccacatcaactccatttccatcaac
agcgactgtgagacgtacatgtcggcggacgacctgcgcatcaacctctggcacctggcc
atcaccgacaggagcttcaacatcgtggacatcaagccggccaacatggaggacctcacg
gaggtgatcaccgcctccgagttccacccgcaccactgcaacctcttcgtctacagcagc
agcaagggctccctgcgcctctgcgacatgcgggcggccgccctgtgcgacaagcactcc
aaactctttgaggaacctgaggaccccagtaaccgctccttcttctcagaaatcatctcc
tccgtgtccgacgtgaagttcagccacagcggccggtacatgctcacccgggattatctc
acggtcaaggtctgggacctgaacatggaggcgaggcccatcgagacctaccaggtgcac
gattaccttcgcagcaagctctgttccttgtacgagaacgactgcatcttcgacaagttc
gaatgcgcctggaacgggagcgacagcgtcatcatgaccggtgcctacaacaacttcttc
cgcatgttcgaccgcaacaccaagcgtgacgtgacgctggaggcctccagggagagcagc
aagccccgggccgtgctcaagccgcggcgcgtgtgcgtgggcggcaagcgccggcgggac
gacatcagcgtggacagcttggacttcaccaagaagatcctgcacacggcctggcacccg
gccgagaacatcatcgccatcgcggccaccaacaacctgtacatcttccaggacaaggtg
aactccgagatgcactag

KEGG   Miniopterus natalensis: 107525394
Entry
107525394         CDS       T05883                                 

Gene name
PPP2CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04136  Autophagy - other
mna04140  Autophagy - animal
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04350  TGF-beta signaling pathway
mna04390  Hippo signaling pathway
mna04530  Tight junction
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna05142  Chagas disease
mna05160  Hepatitis C
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107525394 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107525394 (PPP2CA)
   04390 Hippo signaling pathway
    107525394 (PPP2CA)
   04071 Sphingolipid signaling pathway
    107525394 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    107525394 (PPP2CA)
   04152 AMPK signaling pathway
    107525394 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107525394 (PPP2CA)
   04136 Autophagy - other
    107525394 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107525394 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107525394 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107525394 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    107525394 (PPP2CA)
   04730 Long-term depression
    107525394 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107525394 (PPP2CA)
   05165 Human papillomavirus infection
    107525394 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107525394 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107525394 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107525394 (PPP2CA)
   04131 Membrane trafficking [BR:mna04131]
    107525394 (PPP2CA)
   03036 Chromosome and associated proteins [BR:mna03036]
    107525394 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107525394 (PPP2CA)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107525394 (PPP2CA)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     107525394 (PPP2CA)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107525394 (PPP2CA)
Membrane trafficking [BR:mna04131]
 Autophagy
  Other autophagy associated proteins
   Others
    107525394 (PPP2CA)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107525394 (PPP2CA)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107525394 (PPP2CA)
SSDB
Motif
Pfam: Metallophos Glyco_hydro_65N STPPase_N YqzH
Other DBs
NCBI-GeneID: 107525394
NCBI-ProteinID: XP_016053039
LinkDB
Position
Unknown
AA seq 309 aa
MDEKVFTKELDQWIEQLNECKQLSEPQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggaactggaccagtggatcgagcagctgaatgagtgc
aagcagctctcagagccccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaggttcgatgtccagtcactgtctgtggagatgttcatggg
caatttcatgatctcatggaactgtttagaattggtggcaagtcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatactattcagttgaaacagttactctgctt
gtagctcttaaggttcgttaccgtgaacgcatcactattcttcgaggaaatcatgagagc
agacagatcacacaagtatatggtttctatgatgagtgtttaaggaaatatggaaatgca
aatgtttggaaatactttacagatctttttgactatcttcctctcactgctttggtggat
gggcagatcttctgtctacatggtggcctctcgccatccatagatacactggatcacatc
agagcacttgatcgcctacaagaagttccccatgagggtccaatgtgtgacttgctgtgg
tcggatccagatgaccgtggtggttggggtatatctcctcgaggagctggctacacgttt
gggcaagatatttccgagacatttaatcatgccaatggcctcacgttggtgtctagagct
caccagctggtgatggaggggtataactggtgccatgaccggaatgtagtaacaattttc
agtgctccaaactattgttatcgttgtggtaaccaagctgcaatcatggaacttgatgat
actctaaaatactctttcttgcagtttgacccagcacctcgcaggggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

KEGG   Miniopterus natalensis: 107526093
Entry
107526093         CDS       T05883                                 

Gene name
PPP2R3C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04728  Dopaminergic synapse
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107526093 (PPP2R3C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107526093 (PPP2R3C)
   04151 PI3K-Akt signaling pathway
    107526093 (PPP2R3C)
   04152 AMPK signaling pathway
    107526093 (PPP2R3C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107526093 (PPP2R3C)
  09156 Nervous system
   04728 Dopaminergic synapse
    107526093 (PPP2R3C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107526093 (PPP2R3C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107526093 (PPP2R3C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107526093 (PPP2R3C)
   03036 Chromosome and associated proteins [BR:mna03036]
    107526093 (PPP2R3C)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107526093 (PPP2R3C)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107526093 (PPP2R3C)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107526093 (PPP2R3C)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_13 EF-hand_1 EF-hand_5 DUF61
Other DBs
NCBI-GeneID: 107526093
NCBI-ProteinID: XP_016053928
LinkDB
Position
Unknown
AA seq 453 aa
MDWKEVLRRRLGTPNKGPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTTEFYNTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGPKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDNENSADLDDT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggactggaaagaagttcttcgccggcggttagggacgcccaacaaaggtccaaacaaa
aagaaaagtgaacaagaattaaaagatgaagaaatggatttatttactaaatactactca
gaatggaaaggaggtagaaaaaacacaactgaattctataacaccattccccggttttat
tataggctgccagctgaagatgaagtcttactacagaaattaagagaggaatccagagct
gtctttctgcagaggaaaagcagagaactgttagataatgaagaattacagaacttatgg
tttttgctggacaagcaccagacgccacctatgattggagaggaggcaatgattaattat
gaaaattttttgaaggttggtgaaaaagctggaccaaagtgcaagcaatttttcacagca
aaagtctttgctaaactccttcatacagattcttatggaagaatttccatcatgcagttc
tttaattatgtcatgagaaaagtttggcttcatcaaacaagaataggactcagtttatat
gacgttgcaggacaaggataccttcgggaatctgatttagaaaactacatattggaactt
atccctactttgccacaattagatgggctggaaaaatctttttattccttttatgtttgt
acagctgttaggaaattctttttctttttggaccctctaagaacagggaagataaaaatt
caagatattttagcatgcagcttcctagatgatttattggagttaagggatgaggaattg
tccaaggagagtcaagaaactaattggttttctgctccttctgccctaagggtatatggc
cagtatttgaatcttgataaggatcacaatggcatgctcagtaaagaagaactctcccgc
tacggcacggcaaccatgaccaatgtcttcttagaccgtgttttccaggagtgtctcact
tacgatggagaaatggactataagacctacctggattttgttcttgcattagaaaaccga
aaagaacctgcagcactgcaatatattttcaaattgcttgatattgagaacaagggatat
ctgaatgtcttttcccttaattacttctttagggccatacaggaactaatgaaaatccat
ggacaagatcctgtttcatttcaagatgtcaaggatgaaatctttgacatggtaaaacca
aaggatcctttgaaaatctctcttcaggatttaatcaacagtaatcaaggagacacagtc
accaccattctaattgatctgaatggcttctggacttatgagaacagagaagcccttgtt
gcaaatgacaatgaaaactctgcagaccttgatgatacatga

KEGG   Miniopterus natalensis: 107529477
Entry
107529477         CDS       T05883                                 

Gene name
PPP2R2B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04390  Hippo signaling pathway
mna04530  Tight junction
mna04728  Dopaminergic synapse
mna05142  Chagas disease
mna05160  Hepatitis C
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107529477 (PPP2R2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107529477 (PPP2R2B)
   04071 Sphingolipid signaling pathway
    107529477 (PPP2R2B)
   04151 PI3K-Akt signaling pathway
    107529477 (PPP2R2B)
   04152 AMPK signaling pathway
    107529477 (PPP2R2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107529477 (PPP2R2B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107529477 (PPP2R2B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107529477 (PPP2R2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107529477 (PPP2R2B)
   05165 Human papillomavirus infection
    107529477 (PPP2R2B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107529477 (PPP2R2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107529477 (PPP2R2B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107529477 (PPP2R2B)
   03036 Chromosome and associated proteins [BR:mna03036]
    107529477 (PPP2R2B)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107529477 (PPP2R2B)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107529477 (PPP2R2B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107529477 (PPP2R2B)
SSDB
Other DBs
NCBI-GeneID: 107529477
NCBI-ProteinID: XP_016058399
LinkDB
Position
Unknown
AA seq 446 aa
MKCFSRYLPYIFRPPNTILSSSCHTEADIISTVEFNHTGELLATGDKGGRVVIFQREQES
KNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKL
WKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHIN
SISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNT
FVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIM
TRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGS
YNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILH
TAWHPSENIIAVAATNNLYIFQDKVN
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaatgcttctctcgttacctgccttacatcttcagacctccgaacaccatcctctct
tccagctgccacacggaagctgacattatctctacggtagaattcaaccacactggagaa
ttactagcgacaggggacaaggggggtcgggttgtcatatttcaacgagagcaggagagt
aaaaatcaggttcatcgtaggggcgaatacaatgtttacagcacattccagagccatgaa
cccgagttcgattacctgaagagcttagaaatagaagaaaaaatcaataaaataagatgg
ctcccccagcagaatgcagcctacttccttctgtctactaatgataaaactgtgaagctg
tggaaagtcagcgagcgtgataagaggcccgaaggctacaacctgaaagatgaggagggc
cggcttcgggaccctgccaccatcacgaccttgcgggtgcctgtcctcagacccatggac
ctgatggtggaggccaccccgcgaagagtatttgccaacgcacacacatatcacatcaac
tccatatcagtcaacagcgactatgagacctacatgtcggctgatgacctgaggattaac
ctatggaactttgaaataaccaatcaaagttttaacatcgtggacattaagccagccaac
atggaggagctcacggaggtgatcacggcagccgagttccacccgcatcactgcaacacc
ttcgtgtacagcagcagcaaagggacaatccggctgtgcgacatgagggcatccgccctg
tgtgacaggcacaccaaattttttgaagaaccggaagatccaagcaacaggtcgtttttc
tctgaaattatctcttcgatttcggatgtgaagttcagccacagcgggaggtacatcatg
accagggactatctgaccgttaaagtctgggatctcaacatggaaaaccgccccatcgag
acgtaccaggttcatgactacctccgcagcaaattgtgctccctctacgaaaacgactgc
atttttgataaattcgagtgtgtgtggaatgggtcagacagtgtcatcatgaccggctcc
tacaacaacttcttcaggatgtttgaccgaaacaccaagcgtgatgttaccctggaggcc
tcgagggaaaacagcaaaccccgggccattctgaaaccgcgaaaagtgtgcgtggggggc
aagcggagaaaagacgagatcagtgttgacagcctggactttagcaaaaagatcttgcat
acagcttggcatccttcagaaaatattatagcagtggcggctacaaataacctatatata
ttccaggacaaggttaactag

KEGG   Miniopterus natalensis: 107529884
Entry
107529884         CDS       T05883                                 

Gene name
PPP2R2A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04390  Hippo signaling pathway
mna04530  Tight junction
mna04728  Dopaminergic synapse
mna05142  Chagas disease
mna05160  Hepatitis C
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107529884 (PPP2R2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107529884 (PPP2R2A)
   04071 Sphingolipid signaling pathway
    107529884 (PPP2R2A)
   04151 PI3K-Akt signaling pathway
    107529884 (PPP2R2A)
   04152 AMPK signaling pathway
    107529884 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107529884 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107529884 (PPP2R2A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107529884 (PPP2R2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107529884 (PPP2R2A)
   05165 Human papillomavirus infection
    107529884 (PPP2R2A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107529884 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107529884 (PPP2R2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107529884 (PPP2R2A)
   03036 Chromosome and associated proteins [BR:mna03036]
    107529884 (PPP2R2A)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107529884 (PPP2R2A)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107529884 (PPP2R2A)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107529884 (PPP2R2A)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 107529884
NCBI-ProteinID: XP_016058939
LinkDB
Position
Unknown
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagca
gtagatgatgatgtagcagaagcagatataatttcgacagtagaatttaatcattctgga
gaattactagcaacaggagataaaggaggtagagtcgtcatctttcaacaggagcaggag
aacaaaatccagtctcatagcagaggagaatataatgtttacagcacctttcagagccat
gaaccagagtttgactacttgaaaagtttagaaatagaagaaaagatcaacaaaattagg
tggttaccccagaaaaatgctgctcagtttttattgtctaccaatgataaaacaataaaa
ttgtggaaaatcagtgaaagggacaaaagaccagaagggtataacttgaaagaggaagat
ggaaggtatagagatcctactacagtcactacactacgagtgccagtctttaggcccatg
gatctaatggttgaggccagtcctcgaagaatatttgccaatgctcatacataccacatc
aactcaatttctattaatagtgattatgaaacatatttatccgcagatgatttgcgaatt
aatctttggcatctggaaattacagacaggagttttaatattgtggatatcaagcctgcc
aacatggaagagctaacagaagtgattacagcagcagaattccatccaaacagttgtaac
acatttgtttacagcagcagtaaaggaactattcggttatgtgacatgagggcatctgcc
ctctgtgataggcattctaaactgtttgaagaacctgaagatcccagtaacaggtctttc
ttttctgaaataatctcctcgatttctgatgtaaaattcagccatagtggtcgatatatg
atgactagagactacttgtcagtcaaaatttgggacttaaatatggaaaacaggcctgtg
gaaacataccaggtgcatgaatacctcagaagtaaactttgttctctgtatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatggctctgatagtgttgtcatgactgga
tcttacaataatttcttcagaatgtttgacaggaacacaaagcgagacataaccctcgaa
gcatcgcgggagaacaataaacctcgcacggttctgaagccacgcaaagtctgtgcaagt
ggcaagagaaagaaagatgaaataagtgttgacagtctagacttcaacaagaaaatactt
catacagcctggcaccccaaggaaaatatcattgctgtagctactacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Miniopterus natalensis: 107530370
Entry
107530370         CDS       T05883                                 

Gene name
PPP2R2D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04390  Hippo signaling pathway
mna04530  Tight junction
mna04728  Dopaminergic synapse
mna05142  Chagas disease
mna05160  Hepatitis C
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107530370 (PPP2R2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107530370 (PPP2R2D)
   04071 Sphingolipid signaling pathway
    107530370 (PPP2R2D)
   04151 PI3K-Akt signaling pathway
    107530370 (PPP2R2D)
   04152 AMPK signaling pathway
    107530370 (PPP2R2D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107530370 (PPP2R2D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107530370 (PPP2R2D)
  09156 Nervous system
   04728 Dopaminergic synapse
    107530370 (PPP2R2D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107530370 (PPP2R2D)
   05165 Human papillomavirus infection
    107530370 (PPP2R2D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107530370 (PPP2R2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107530370 (PPP2R2D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107530370 (PPP2R2D)
   03036 Chromosome and associated proteins [BR:mna03036]
    107530370 (PPP2R2D)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107530370 (PPP2R2D)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107530370 (PPP2R2D)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107530370 (PPP2R2D)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 107530370
NCBI-ProteinID: XP_016059612
LinkDB
Position
Unknown
AA seq 468 aa
MCLTHEDFSSGLILSERNPGDGGNDLLLLASIWDTRVGVAVCSHLSGWADIISTVEFNYS
GDLLATGDKGGRVVIFQREQENKSRPHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKI
RWLPQQNAAHFLLSTNDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKP
MDLMVEASPRRIFANAHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKP
TNMEELTEVITAAEFHPHQCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRS
FFSEIISSISDVKFSHSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYEN
DCIFDKFECCWNGPDSAIMTGSYNNFFRMFDRNSRRDVTLEASRENSKPRASLKPRRVCP
GGKRKKDEISVDSLDFNKKILHTAWHPTDNIIAVAATNNLYIFQDKAN
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtgtttgacccatgaggacttctcttctggcttgatcctttcagagagaaaccctggg
gatggtggaaatgatttactcctgttggccagcatttgggacacaagagtgggagtagct
gtgtgttctcacctatcaggatgggctgacatcatctcaactgttgaatttaattactct
ggagatcttcttgcaacaggagacaagggtggcagagttgttatttttcagcgggaacaa
gagaataaaagccgccctcattctaggggggaatataatgtttacagtacctttcaaagt
catgaaccagagtttgactatttgaaaagtctagaaattgaggaaaaaattaataaaatt
aggtggttaccacaacagaatgctgctcattttctactctctacaaatgataaaactatt
aaattatggaaaataagtgaacgggataaaagagcagaaggttataacttgaaagatgaa
gatggacgacttcgagacccatttagaattacagcactgcgggtcccaatattgaagccc
atggacctcatggtagaagcaagtccgcgacgaatttttgcaaatgctcacacataccat
ataaattccatttccgtaaacagtgatcatgaaacgtatctttctgcagatgacctgaga
attaacctgtggcatttagagatcacagatagaagctttaacatcgtggacatcaagccc
acgaacatggaggagctgacagaggtgatcactgcggctgagttccaccctcaccagtgc
aacgtgtttgtgtacagcagcagcaaggggaccatccggctgtgcgacatgcgctcctcg
gccctgtgcgaccgacactctaagttttttgaagaacctgaagaccccagcagtagatct
ttcttctcagaaataatttcttccatctccgatgtgaaattcagccatagtggtcggtac
atgatgacccgagactacctgtcggtgaaggtctgggatctcaacatggaaagccggccc
gtggagacccaccaggtccatgagtaccttcgaagcaagctgtgttctctgtacgaaaat
gactgcatcttcgacaagtttgagtgctgctggaatggtccagacagtgcgatcatgacg
gggtcctacaacaacttcttcaggatgtttgacagaaatagtcggagggacgtgaccctg
gaagcttccagagagaacagcaagcctcgagccagtctgaagcctcggagggtgtgtcca
ggcgggaagcggaagaaggacgagatcagtgtggacagtctggacttcaataagaagatt
ctgcacacggcctggcaccccaccgacaacattattgccgtggctgccaccaacaacctg
tacatattccaggacaaagccaactag

KEGG   Miniopterus natalensis: 107531299
Entry
107531299         CDS       T05883                                 

Gene name
PPP2R1B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04350  TGF-beta signaling pathway
mna04390  Hippo signaling pathway
mna04530  Tight junction
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna05142  Chagas disease
mna05160  Hepatitis C
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107531299 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107531299 (PPP2R1B)
   04390 Hippo signaling pathway
    107531299 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    107531299 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    107531299 (PPP2R1B)
   04152 AMPK signaling pathway
    107531299 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107531299 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107531299 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107531299 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107531299 (PPP2R1B)
   04730 Long-term depression
    107531299 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107531299 (PPP2R1B)
   05165 Human papillomavirus infection
    107531299 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107531299 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107531299 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107531299 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:mna03036]
    107531299 (PPP2R1B)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107531299 (PPP2R1B)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107531299 (PPP2R1B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107531299 (PPP2R1B)
SSDB
Motif
Pfam: HEAT HEAT_2 HEAT_EZ Vac14_Fab1_bd Cnd1 Adaptin_N M11L CLASP_N AEP1 IFRD DUF3730
Other DBs
NCBI-GeneID: 107531299
NCBI-ProteinID: XP_016060824
LinkDB
Position
Unknown
AA seq 410 aa
MVRRAAASKLGEFAKVLELDSVKSEIVPLFTNLASDEQDSVRLLAVEACVSIAQLLSQDD
LEVLVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITQNDLIPAFQNLLKDCEAEVR
AAAAHKVKDLCENLPIEGRETIIMNQVLPYIKELVSDTNQHVKSALASVIMGLSTILGKE
NTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRV
RLAIIEYMPLLAGQLGVEFFDEKLNALCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQ
NTIVPKVLVMANDPNYLHRMTTLFCINVLSEACGQEITTKQMLPIVLKMAGDQVANVRFN
VAKSLQKIGPILDTDALQEEVKPVLQKLGQDEDMDVKYFAQEAISVLALA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggtacgacgtgctgctgcttccaaattgggcgaatttgcgaaggttttagaattagac
agtgtgaaaagtgaaatcgttccattgtttactaatctagcttcagatgaacaggattca
gtgcgcctccttgctgtggaagcttgtgtcagtattgcccagttactgtctcaggatgac
cttgaggttttggtgatgccaacacttcgacaagctgcggaagataaatcttggcgagtt
cggtatatggtagccgacaaattttcagagctccagaaagctgtgggccctaaaatcacc
cagaatgacctcatccctgcctttcagaacctacttaaagactgtgaagctgaagtccga
gcagctgctgcccacaaagtgaaagatctttgtgagaacttgcccattgaaggtagagag
accataattatgaatcaagttctgccctatataaaggaattagtatctgatacaaatcaa
catgtcaaatcggctctagcttctgtgattatgggattgtctactattttgggcaaagag
aacaccattgaacatcttctgcctctttttttagctcagttaaaggatgagtgtcctgaa
gttcgtttgaatatcatctccaatttggactgtgtaaatgaagtgattggaatccgccag
ctctctcagtctctccttcctgccatagtggagctggctgaagatgccaagtggagggtc
cggctggccatcattgagtacatgccactgctggcaggccagctgggtgtggaattcttt
gatgaaaagctgaatgctttatgtatggcctggcttgtggaccacgtgtatgccattcgt
gaagctgctaccaacaacctcatgaaactagttcagaagtttggtacagagtgggcccaa
aataccatcgttcccaaagtgttagtaatggcaaacgatcctaattatttgcatagaatg
accactttattctgcattaatgtactgtctgaagcctgtggtcaggaaataaccactaag
cagatgctgcccattgtattgaaaatggcaggagaccaagtggcgaacgtccgtttcaat
gtggccaaatctctacagaaaattggaccaattctagataccgatgctttgcaggaggaa
gttaagccggtactgcagaagttaggccaagatgaagacatggatgtcaagtacttcgca
caggaagctataagtgtgcttgcgttggcatga

KEGG   Miniopterus natalensis: 107533585
Entry
107533585         CDS       T05883                                 

Gene name
PPP2R5B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04728  Dopaminergic synapse
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107533585 (PPP2R5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107533585 (PPP2R5B)
   04151 PI3K-Akt signaling pathway
    107533585 (PPP2R5B)
   04152 AMPK signaling pathway
    107533585 (PPP2R5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107533585 (PPP2R5B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107533585 (PPP2R5B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107533585 (PPP2R5B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107533585 (PPP2R5B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107533585 (PPP2R5B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107533585 (PPP2R5B)
   03036 Chromosome and associated proteins [BR:mna03036]
    107533585 (PPP2R5B)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107533585 (PPP2R5B)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107533585 (PPP2R5B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107533585 (PPP2R5B)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 107533585
NCBI-ProteinID: XP_016063817
LinkDB
Position
Unknown
AA seq 497 aa
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHDLLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCSHIFL
RFIYELEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKE
APLQRLTSQVAASGGQS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagacaaagctgccccctgcgagtacccccaccagcccctcttccccggggctttcg
cctgtgcccccaccggacaaggtggatggcttctctcgccggtccctccgcagggcccgg
ccccggaggtcccatagctcctctcagttccgctatcagagcaaccagcaggagctcact
ccactgcccctgctcaaagatgtgccggcctctgagctgcatgatctgctgagcaggaag
ctggcccagtgcggggtgatgtttgacttcttggactgtgtggcggacctcaaggggaag
gaggtgaagcgggcagcgctcaatgagctggtggagtgtgtggggagcacccggggggtc
ctcattgagcctgtctacccagacatcatccgcatgatctcggtgaatatcttccggacc
ctgccgcccagtgagaaccctgaatttgaccctgaagaggatgagcccaaccttgagcct
tcatggccacatcttcagctggtatacgagtttttcctgcgtttcttggagagcccagac
ttccagccctccgtggccaagagatatgtggatcaaaagtttgtcctgatgctcctggag
ctgtttgatagtgaggacccccgggagcgtgagtacctcaagaccatcctgcaccgggtc
tacggcaagttcctggggctccgggcctacatccgcaagcagtgcagccacatcttcctc
cggttcatctatgaactcgagcacttcaatggcgtggctgagctgctagagatcttagga
agcatcatcaatggctttgcgctgcccctgaagactgagcacaagcagttcctggttcgg
gtcctgattcccttgcactccgttaagtcgctgtctgtctttcacgcccagctggcatac
tgtgtggtgcagttcctggaaaaggacgccaccttgacagagcatgtgatccggggactg
ctcaaatactggccaaaaacctgcacccagaaggaggtgatgtttctgggggagatggaa
gagattcttgatgtcattgagccctcccagtttgtgaagatccaggagcccctctttaag
caggtggctcgctgtgtgtccagcccccatttccaggttgcagagcgggctctgtatttc
tggaacaacgagtatatcctgagcctcattgaggacaactgccacactgtgctgcctgct
gtgtttgggaccctctaccaagtctccaaggagcactggaatcaaaccatcgtatctctg
atctataacgtgctgaagaccttcatggagatgaatgggaagctgtttgatgagctcaca
gcctcctacaagctggaaaagcagcaggagcagcagaaggcccaggagcgtcaggagctg
tggcaaggcctggaggagctacggctacgccggttacaggggacccagggggcaaaagag
gcccccctccagcgccttacatcccaggtggctgccagtgggggtcagagctag

KEGG   Miniopterus natalensis: 107534103
Entry
107534103         CDS       T05883                                 

Gene name
PPP2CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04136  Autophagy - other
mna04140  Autophagy - animal
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04350  TGF-beta signaling pathway
mna04390  Hippo signaling pathway
mna04530  Tight junction
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna05142  Chagas disease
mna05160  Hepatitis C
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107534103 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107534103 (PPP2CB)
   04390 Hippo signaling pathway
    107534103 (PPP2CB)
   04071 Sphingolipid signaling pathway
    107534103 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    107534103 (PPP2CB)
   04152 AMPK signaling pathway
    107534103 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107534103 (PPP2CB)
   04136 Autophagy - other
    107534103 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107534103 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107534103 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107534103 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    107534103 (PPP2CB)
   04730 Long-term depression
    107534103 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107534103 (PPP2CB)
   05165 Human papillomavirus infection
    107534103 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107534103 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107534103 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107534103 (PPP2CB)
   04131 Membrane trafficking [BR:mna04131]
    107534103 (PPP2CB)
   03036 Chromosome and associated proteins [BR:mna03036]
    107534103 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107534103 (PPP2CB)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107534103 (PPP2CB)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     107534103 (PPP2CB)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107534103 (PPP2CB)
Membrane trafficking [BR:mna04131]
 Autophagy
  Other autophagy associated proteins
   Others
    107534103 (PPP2CB)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107534103 (PPP2CB)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107534103 (PPP2CB)
SSDB
Motif
Pfam: Metallophos Glyco_hydro_65N
Other DBs
NCBI-GeneID: 107534103
NCBI-ProteinID: XP_016064566
LinkDB
Position
Unknown
AA seq 244 aa
MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQ
VYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDR
LQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVM
EGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTP
DYFL
NT seq 735 nt   +upstreamnt  +downstreamnt
atggaactctttagaattggaggaaaatcaccagatacaaactatctgttcatgggtgac
tatgtagacagaggctattattcagtggagactgtgactcttcttgtggcattaaaggtg
cgttatccagaacgtattacaatattgagaggaaaccacgaaagccgacaaattacccaa
gtatatggcttttatgatgaatgcctacgaaagtatggaaatgccaatgtttggaaatac
tttacagatctgtttgattatcttccactgacagctttagtagatggacagatattctgc
ctccacggtggcctctctccatccatagatacactggaccatataagggccctggatcgg
ttacaagaagttccacatgagggcccgatgtgtgatctgttatggtcagatccagatgat
cgtggtggatggggtatttcaccacgtggtgctggctacacatttggacaagacatttct
gaaacatttaatcatgccaatggcctcaccctggtttcccgcgctcaccagcttgtaatg
gagggatacaattggtgtcatgatcggaatgtggttaccattttcagtgcacccaattac
tgttatcgttgtgggaaccaggctgctatcatggaattagatgacactttaaaatattcc
ttccttcagtttgacccagcacctcgtcgtggagagcctcacgttacccggcgcacccca
gactacttcctataa

KEGG   Miniopterus natalensis: 107536493
Entry
107536493         CDS       T05883                                 

Gene name
PPP2R5C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04728  Dopaminergic synapse
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107536493 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107536493 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    107536493 (PPP2R5C)
   04152 AMPK signaling pathway
    107536493 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107536493 (PPP2R5C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107536493 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    107536493 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107536493 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107536493 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107536493 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:mna03036]
    107536493 (PPP2R5C)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107536493 (PPP2R5C)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107536493 (PPP2R5C)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107536493 (PPP2R5C)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 107536493
NCBI-ProteinID: XP_016067704
LinkDB
Position
Unknown
AA seq 523 aa
MLTCNKAGRMVVDAANSNGPFQPVALLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLS
DLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPE
EDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDF
LKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETERHNGIAELLEILGSIINGFALPLKE
EHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPKE
VMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISD
NAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKL
KMKEREEAWVKIESLAKANPQYTVLSQASTMSIPVAMETDGPLFEDVQRLRKAVSEEARQ
AQKDLKKDRALMRRKSELPQDLHTKNALEAHCRADELLSQDGR
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgttgacatgtaataaagcgggcaggatggtggtggatgcggccaactccaacgggcct
ttccagcccgtggcccttctccatattcgagatgttcctcctgctgatcaagagaagctt
tttatccagaagttacgtcagtgttgtgtcctctttgactttgtttccgatccactaagt
gacctaaagtggaaggaagtaaaacgagctgctttaagtgagatggtggaatacatcacc
cacaatcggaatgtgatcacagagcctatctacccggaagtggtccatatgtttgcagtt
aacatgtttcgaacattaccaccttcctccaatcctacgggagcagaatttgacccagaa
gaagatgaaccaacattagaagcggcctggcctcacctacagcttgtttatgaatttttc
ttaagatttttagagtctcctgatttccaacctaatatagcgaagaaatatattgatcag
aagtttgtattgcagcttttagagctctttgacagtgaagatcctcgagagagagatttt
cttaaaactacccttcacagaatctacgggaaattcttaggcttaagagcttacatcaga
aaacagataaataatatattttataggtttatttatgaaacagagcgtcacaatggcata
gcagagttactggaaatactgggaagtataattaatggatttgccttaccactaaaagaa
gagcacaagattttcttattgaaggtgttactacctttgcacaaagtgaaatctctgagt
gtctaccacccccagcttgcgtactgtgtcgtgcagtttctggagaaggacagcaccctc
acggagccagtggtaatggcactgctcaaatactggccaaagactcacagtccaaaagaa
gtaatgttcttgaatgagttagaagaaattttagatgtgatcgaaccatcggaatttgtc
aagatcatggagccactcttccggcagttggccaagtgcgtctccagcccgcacttccag
gtggcggagcgcgcgctgtactactggaacaatgagtacatcatgagcctgatcagtgac
aacgcggccaagatcctgcccatcatgttcccgtccttgtaccgcaactcaaagacccac
tggaacaagacaatacatggcttgatatacaacgcgctgaaactcttcatggagatgaac
caaaaactatttgatgactgcacccagcagtttaaagcagagaaactgaaagagaagcta
aaaatgaaagaacgagaagaagcgtgggttaaaatcgaaagtctagccaaagcaaacccc
cagtacacggtacttagtcaagcgagcaccatgagcatcccggttgccatggagacagat
gggcccttatttgaagatgtgcagaggctgagaaaggcagtgagcgaagaggctcggcag
gcacagaaggacctgaagaaggaccgggctctgatgcgccgcaagtccgagctgcctcag
gacctccacaccaagaacgccttggaggctcactgcagagccgacgagctgctgtcccag
gacggccgctag

KEGG   Miniopterus natalensis: 107536901
Entry
107536901         CDS       T05883                                 

Gene name
PPP2R5D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04728  Dopaminergic synapse
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107536901 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107536901 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    107536901 (PPP2R5D)
   04152 AMPK signaling pathway
    107536901 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107536901 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107536901 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    107536901 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107536901 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107536901 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107536901 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:mna03036]
    107536901 (PPP2R5D)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107536901 (PPP2R5D)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107536901 (PPP2R5D)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107536901 (PPP2R5D)
SSDB
Motif
Pfam: B56 Ndc1_Nup
Other DBs
NCBI-GeneID: 107536901
NCBI-ProteinID: XP_016068275
LinkDB
Position
Unknown
AA seq 604 aa
MPYKLKKEKEPPKLAKGTAKPSSSGKDGGGESAEEAQPQPQPQSQPQPQPQSQPSSSNKR
PSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELF
IQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVN
LFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQK
FVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIA
ELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESTLT
EPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMDPLFRQLAKCVSSPHFQV
AERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQ
KLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETET
PTAEDIQLLKRTVETEAVQMLKDMKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTAS
QEAL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgccctataaactgaagaaggagaaggagccccccaagcttgccaaaggcacggccaag
cccagcagctcgggcaaggatggtggaggcgagagtgctgaggaggctcagccccagccc
cagccacaatcccagccccagccgcagccccagtctcagccatcgtcatccaacaagcgt
cccagcaacagcacgccaccccccacacagctcagcaaaatcaagtactcagggggcccc
cagattgtcaagaaggagagacggcaaagctcctcccgcttcaatctcagcaagaaccgg
gagttgcagaagcttcctgccctgaaagattcgccaacccaggaacgggaggagctgttt
atccagaagctacgccagtgctgcgtcctctttgactttgtgtcagacccactaagtgac
ctcaaattcaaggaggtgaagcgggccggactcaacgaaatggtggagtacatcacccat
agccgggatgttgtcaccgaggccatttaccctgaggctgtcaccatgttttcagtgaac
ctcttccggacactgccaccttcatcaaatcccactggggccgagtttgacccagaggaa
gatgagcccaccctggaagctgcctggccacatctccagctcgtgtatgagtttttctta
cgtttccttgagtctcctgatttccagccaaacatagccaagaagtacattgaccagaag
tttgtccttgctctcctagacctgtttgacagtgaggatcctcgagagcgggacttcctc
aagaccatcttgcatcgaatctatggcaagtttttggggctccgagcttatatccgtagg
cagatcaaccacatcttctacaggttcatctatgagacagagcatcacaatgggattgcc
gagctcctggagatcttgggcagcatcatcaacggctttgccttgccccttaaggaagag
cacaagatgttccttatccgtgtcctgcttccccttcacaaggtcaagtccctaagtgtc
taccaccctcagctggcatactgtgtggtacaattcctggagaaggagagcactctcact
gagccggtgattgtgggacttctcaagttctggccgaagactcacagccccaaggaagtg
atgttcctgaatgagctggaggagattctggatgtcattgaaccttcagagttcagcaaa
gtgatggaccccctcttccgccagcttgccaagtgtgtctccagcccccatttccaggtg
gcagagcgtgccctctattactggaacaatgagtacatcatgagcctgataagtgacaat
gctgcccgagtcctccccatcatgttccccgcactctacaggaactccaagagccactgg
aacaagacaatccatggactgatctacaacgccctgaagctgtttatggagatgaatcag
aagctgtttgatgactgcacacaacaatacaaggcagagaagcagaagggccggttccga
atgaaggaaagagaagagatgtggcaaaagattgaagagctggcccgactcaatccccag
tatcccatgttccgagctccaccaccactgccccctgtgtactcgatggagacagagacc
cccacagcagaggacatacagcttctgaagaggacagtggagacagaagctgtgcagatg
ctaaaggacatgaagaaggagaaagtgctgcttcggaggaagtcagagctgccccaggat
gtgtacaccattaaggcgctagaggctcacaagcgggcagaagagttcttaactgccagc
caggaggctctctga

KEGG   Miniopterus natalensis: 107540441
Entry
107540441         CDS       T05883                                 

Gene name
PPP2R1A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04350  TGF-beta signaling pathway
mna04390  Hippo signaling pathway
mna04530  Tight junction
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna05142  Chagas disease
mna05160  Hepatitis C
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107540441 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107540441 (PPP2R1A)
   04390 Hippo signaling pathway
    107540441 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    107540441 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    107540441 (PPP2R1A)
   04152 AMPK signaling pathway
    107540441 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107540441 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107540441 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107540441 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107540441 (PPP2R1A)
   04730 Long-term depression
    107540441 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107540441 (PPP2R1A)
   05165 Human papillomavirus infection
    107540441 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107540441 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107540441 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107540441 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:mna03036]
    107540441 (PPP2R1A)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107540441 (PPP2R1A)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107540441 (PPP2R1A)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107540441 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 107540441
NCBI-ProteinID: XP_016072688
LinkDB
Position
Unknown
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSSDCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALSVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggcggctgacggcgacgactctctctaccccatcgcggtgctcatagacgagctc
cgcaacgaggatgttcagcttcgcctcaacagcatcaagaagctgtccaccatcgccttg
gctctcggggtggaaaggacccgcagtgagcttctgcccttccttacagacaccatctac
gatgaggatgaggtcctcttggccctggcggaacagctgggaaccttcaccacgctggtc
ggaggcccagagtacgtgcactgcctgctgccacccctggagtcgctggccacagtggag
gagacagtggtacgggacaaggcagtggagtccctgcgggccatctctcacgagcactcg
ccctccgacctggaggcccactttgtgccactggtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcagcctgtggcctcttctctgtctgctacccccgcgtgtccagt
gccgtcaaggctgaacttcgacagtacttccggaacctgtgctcagatgatacccctatg
gtgcggcgggccgcagcctccaagctgggggagttcgccaaggtgctggagctggacaat
gtcaagagtgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggccgtggaggcgtgtgtgaacatcgcccagctcctgccccaggaggatctg
gaagccctggtgatgcccaccctgcgccaggctgctgaggacaaatcctggcgcgtccga
tacatggtggctgacaaattcacagagctccagaaagccgtggggcctgagatcaccaag
acggacttggtccccgccttccagaacctaatgaaagactgtgaggctgaggtgagggcc
gcagcctcccacaaggtcaaagaattctgtgaaaacctctcatctgactgtcgggagaat
gtgatcatgacccagatcttgccctgcatcaaggagctggtgtcagacgccaaccagcat
gtcaaatcggccctggcctcagtcatcatgggcctctctcccatcctgggcaaagataac
accatcgagcacctcctacccctcttcctggctcagttgaaggatgagtgcccagaggtg
cggctcaacatcatctccaacctggactgcgtgaatgaggtgatcggcatccggcagctg
tcccagtccctgctccccgccatcgtggaactggctgaggacgccaagtggcgggtgcgg
ctggccatcattgagtacatgcccctgctggctgggcagctgggggtggagttttttgat
gagaaactcaactccttgtgcatggcctggctcgtggatcatgtctatgccatccgcgag
gcagccaccagcaacctgaagaagttggtggagaagtttgggaaggagtgggcccatgcc
actatcatccccaaggtcttggccatgtctggggatcccaactacctgcaccgcatgacg
acactcttctgcatcaatgtgctctctgaggtctgtgggcaggacatcaccaccaagcac
atgctgcccacggtgctgcgtatggctggggaccccgtcgccaacgttcgcttcaatgtg
gccaagtccctgcagaagatagggcccatcctggacaacagcacactgcagagtgaagtc
aagcccatcctagagaagctgacccaggaccaggatgtggatgtcaagtactttgcccag
gaagccctgagtgttctgtctctcgcctga

KEGG   Miniopterus natalensis: 107542012
Entry
107542012         CDS       T05883                                 

Gene name
PPP2R5A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04728  Dopaminergic synapse
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107542012 (PPP2R5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107542012 (PPP2R5A)
   04151 PI3K-Akt signaling pathway
    107542012 (PPP2R5A)
   04152 AMPK signaling pathway
    107542012 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107542012 (PPP2R5A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107542012 (PPP2R5A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107542012 (PPP2R5A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107542012 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107542012 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107542012 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:mna03036]
    107542012 (PPP2R5A)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107542012 (PPP2R5A)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107542012 (PPP2R5A)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107542012 (PPP2R5A)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 107542012
NCBI-ProteinID: XP_016074700
LinkDB
Position
Unknown
AA seq 486 aa
MSSSSPPAGAASAAISASEKVDGFTRKSVRKALRQKRSQGSSQFRCQGSQAELHPLPQLK
DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET
EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFGSLYKISKEHWNPTIVALVYNVLK
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALENQNSAYNMHSIL
SNTSDE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgtcgccgccggcgggggctgccagcgccgccatctcggcctcggagaaa
gtggacggcttcacccggaaatcggtgcgcaaggcgctgaggcagaagcgctcccagggc
tcgtcgcagttccgctgccagggcagccaggcggagctgcaccccttgccccaactcaaa
gatgccacttcaaatgaacaacaagagctcttctgtcagaagttgcaacagtgttgtata
ctgtttgatttcatggactctgtttcagacttgaagagcaaagaaattaaaagagcaaca
ctgaatgaactggttgagtatgtttcaactaatcgtggtgtaattgttgaatcagcgtat
tctgatatagtaaaaatgatcagtgctaacatcttccgtactcttcctccaagtgataat
ccagattttgatccagaggaggatgagcccacacttgaggcctcttggcctcacatacaa
ttggtgtatgaattcttcttaagatttttggagagccccgatttccagcctagcattgca
aagcgatacattgatcagaaatttgtacaacagctcttggagctttttgatagtgaagat
cccagagaacgtgacttcctgaagactgttctgcatcgaatttatgggaaatttcttgga
ttaagagcattcatcagaaaacaaattaacaacattttcctcaggtttatatatgaaaca
gaacatttcaatggtgttgctgaactcctggaaatattaggaagtattatcaatggcttt
gcattgccactgaaagcagaacataaacaatttctaatgaaggttcttattcctatgcat
actgcaaaaggattagctttgttccatgctcagctagcctactgtgttgtacagttcctg
gagaaagatacaacactaacagaaccagtgatcagaggattgctgaaattttggccaaaa
acatgcagccagaaagaggtgatgtttttaggagaaattgaagaaatcttagatgtcatt
gaaccaacacagttcaaaaaaattgaagagcccctttttaagcaaatatctaagtgtgta
tccagttctcattttcaggttgcagaaagggcattgtacttctggaataatgaatatatt
cttagtttgattgaggagaatattgataaaattctgccaattatgtttggtagtttgtac
aaaatctccaaagaacactggaatccgaccatcgtggcgctggtctacaatgtgctgaaa
accctaatggagatgaatggcaagctttttgatgatcttactagctcctacaaagctgaa
agacaaagggagaaaaagaaggaattggaacgtgaagaattatggaaaaaattagaggag
ctaaaactaaagaaagctctagaaaaccagaacagcgcttacaacatgcacagtattctc
agcaatacaagtgatgaataa

KEGG   Miniopterus natalensis: 107545227
Entry
107545227         CDS       T05883                                 

Gene name
PPP2R3B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04728  Dopaminergic synapse
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107545227 (PPP2R3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107545227 (PPP2R3B)
   04151 PI3K-Akt signaling pathway
    107545227 (PPP2R3B)
   04152 AMPK signaling pathway
    107545227 (PPP2R3B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545227 (PPP2R3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107545227 (PPP2R3B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107545227 (PPP2R3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107545227 (PPP2R3B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107545227 (PPP2R3B)
   03036 Chromosome and associated proteins [BR:mna03036]
    107545227 (PPP2R3B)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107545227 (PPP2R3B)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107545227 (PPP2R3B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107545227 (PPP2R3B)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_1 EF-hand_6
Other DBs
NCBI-GeneID: 107545227
NCBI-ProteinID: XP_016078754
LinkDB
Position
Unknown
AA seq 479 aa
KRLKAFQQVQRKKEEPRPPATSQSIPTFYFPRGRPQDTVSTDAVIARIERTFAQFPHERA
TMEDMGTVAKACGCPRYWKGPLFYAAGGERTGSVSVHKFVAMWRKILQNCHDEATRFVHL
LMNPGCNYLVQEDFVPFLQDVVNTHPGLAFLKEASEFHSRYITTVIQRIFYTVNRSWSGR
ITCAELRRSTFLQNVALLEEEADINQLTEYFSYEHFYVIYCKFWELDTDHDLLIDQQDLA
RHNDHAISTKMIERIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCM
DLDGDGALSMFELEYFYEEQCRRLDCMAIEALPFEDCLCQMLDLVKPQSEGKITLRDLKR
CKLANVFFDTFFNIEKYLDHEQKEQASLLRETETEGPELSDWEKYAAEEYDILVAEEAVG
EPWDDGYEAELSPVDQKLSALRTPLAQRSFFETPSALGAVHLYDYECECDCSDEDLQPS
NT seq 1440 nt   +upstreamnt  +downstreamnt
aagaggctcaaggccttccagcaggtccagaggaagaaggaagagccccggccgccggcc
accagccagagcatccccaccttctacttccctcgtggccggccacaggacacggtgagc
acggatgctgtcatcgccaggatcgagaggacattcgcccagttcccgcacgagcgggcc
accatggaggacatgggcacggtagccaaggcctgcggatgcccgcggtactggaagggg
ccgcttttctacgccgccgggggagagcgcacaggctctgtctccgtccacaagttcgtg
gccatgtggagaaagatcctgcagaactgccatgacgaggccactaggtttgttcacctg
ctcatgaaccctggctgcaactacctggtgcaggaggacttcgtcccctttctgcaggac
gtggtgaacacccaccccggcctggccttcctgaaggaggcatctgagttccactctcgc
tacatcaccaccgtcatccagaggatcttctacacagtcaacaggtcctggtccgggagg
atcacctgtgcagagctccggaggagcaccttcctgcagaacgtggccctgctagaggag
gaggcagacatcaaccagctgaccgagtacttctcctatgagcatttctatgtcatctac
tgcaagttctgggagctggacactgaccacgacctgctcatcgaccagcaggacctggcc
cggcacaacgaccacgccatctccacgaaaatgatcgagaggatcttctcgggagctgtg
acgagaggtagaaaagtccagaaggaaggaaagataagctatgccgacttcgtctggttt
ctcatctctgaggaagacaagaaaacaccgaccagcattgagtactggttccggtgcatg
gacctggatggggacggggcgctgtccatgtttgagctcgagtacttctacgaggagcag
tgccgccggctggactgcatggccatcgaggccctgcccttcgaggactgcctgtgccag
atgctggacctggtgaagcctcagagtgaagggaagatcacactccgagacctcaagagg
tgcaagctcgccaatgtcttcttcgacacctttttcaacattgagaagtacctggaccac
gagcagaaggagcaggcgtccctgctcagggagacggagactgagggccccgagctgtcg
gactgggagaagtacgcagccgaggagtatgacatcctggtggccgaggaggctgtgggg
gagccctgggatgacgggtatgaggcggagctgagccccgtggaccagaagctgagcgcc
ctgcggacgcccctggcccagaggtccttcttcgagacgccgtctgcgctgggcgctgtc
cacctgtatgactacgagtgcgagtgtgattgcagcgacgaggacctgcagccctcctga

KEGG   Miniopterus natalensis: 107545671
Entry
107545671         CDS       T05883                                 

Gene name
PPP2R5E
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04728  Dopaminergic synapse
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107545671 (PPP2R5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107545671 (PPP2R5E)
   04151 PI3K-Akt signaling pathway
    107545671 (PPP2R5E)
   04152 AMPK signaling pathway
    107545671 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107545671 (PPP2R5E)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545671 (PPP2R5E)
  09156 Nervous system
   04728 Dopaminergic synapse
    107545671 (PPP2R5E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107545671 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107545671 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107545671 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:mna03036]
    107545671 (PPP2R5E)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107545671 (PPP2R5E)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107545671 (PPP2R5E)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107545671 (PPP2R5E)
SSDB
Motif
Pfam: B56 Sec7_N SBF2
Other DBs
NCBI-GeneID: 107545671
NCBI-ProteinID: XP_016079286
LinkDB
Position
Unknown
AA seq 476 aa
MLPFLFSRDMSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLL
KDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQT
YPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSI
AKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYE
TEHFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQF
LEKDPSLTEPVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVRIQEPLFKQIAKC
VSSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVL
KAFMEMNSTMFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgttaccttttctcttcagtagggatatgtcctcagcaccaactactcctccatcagtg
gataaagtagacggattttctcggaagtccgtcagaaaagccagacagaagaggtcgcaa
agctcctcacagtttaggtctcaaggcaagcctattgagttaacacctctgccactgctg
aaagacgttccatcctcagagcagcctgaactgttcctaaagaaacttcagcagtgctgt
gtcatttttgacttcatggacacgctatctgatcttaaaatgaaagaatacaagcgctcc
actcttaatgaactggtggactacattacaataagcagaggctgtttgacagagcagact
taccctgaagtagttagaatggtatcttgcaatatattcagaactctccctcctagtgac
agcaatgaatttgatccagaagaagatgaacctacccttgaggcatcgtggccacattta
cagcttgtatatgaatttttcatacgatttttggaaagccaagaattccaacccagcatt
gccaaaaaatacatagatcagaaatttgtattacagcttttggagctatttgacagcgaa
gaccctcgggaacgggactacttaaaaacagtcttacacagaatttatggcaagtttctt
ggtcttagagcatttatccgaaaacagattaacaatatttttctaaggtttgtttatgaa
acagaacacttcaatggtgtagctgaactgctggaaatattaggaagtattatcaatggc
tttgctttacctctgaaggcagaacacaaacagttcctggtgaaagtgctgatcccttta
cataccgtcaggagcttatcactcttccacgcccagctggcatattgcatagtacagttt
ctggagaaagatccttcactcacagaaccagttattagggggttaatgaaattttggccc
aaaacatgtagtcagaaagaggttatgttccttggggagctggaagaaatattggatgtg
attgaaccttcacaatttgttagaattcaagaacctttgtttaaacaaattgccaagtgt
gtatctagcccccattttcaggtggctgaaagggcactctattattggaataatgaatac
atcatgagtttgatagaagaaaactcgaatgtcatccttcccatcatgttttccagtctt
tataggatttcaaaagaacattggaatccggccatcgtggcgctagtctacaacgtgttg
aaggcgtttatggaaatgaacagcaccatgtttgacgagctgacagccacatacaagtca
gatcgccagcgtgagaaaaagaaagaaaaggagcgcgaggaactgtggaagaaactggag
gacctggagttgaagagaggtctcaggcgcgacgggataattcccacttaa

KEGG   Miniopterus natalensis: 107546091
Entry
107546091         CDS       T05883                                 

Gene name
PPP2R3A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04728  Dopaminergic synapse
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107546091 (PPP2R3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107546091 (PPP2R3A)
   04151 PI3K-Akt signaling pathway
    107546091 (PPP2R3A)
   04152 AMPK signaling pathway
    107546091 (PPP2R3A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107546091 (PPP2R3A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107546091 (PPP2R3A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107546091 (PPP2R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107546091 (PPP2R3A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107546091 (PPP2R3A)
   03036 Chromosome and associated proteins [BR:mna03036]
    107546091 (PPP2R3A)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107546091 (PPP2R3A)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107546091 (PPP2R3A)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107546091 (PPP2R3A)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 DUF4187 DUF4116 MSG
Other DBs
NCBI-GeneID: 107546091
NCBI-ProteinID: XP_016079831
LinkDB
Position
Unknown
AA seq 1148 aa
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGSCHTFTHGVDCLVVHRSVCADLHIPVS
QFKDTDLDSMFLPHENGFSSAESDYPHQALTGIRVKKGSTLQNTCNLKDIAGEAISFASG
KIKEFSLEKLKNSNHAAYKKGRKVKSDSFNRRSVDFDLLCGHYNSDGNSSSFGLLRSSSV
EEKSLSHRNSLDMNLTSMFLHNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSED
LKKCTDIIKQCIKKKSDSSINEGNGNDAVSSSETVYMNVMTRLASYLKKLPFEFMQSGNN
EAIDLTELVSNMPSLQLTPFSPIFGTEQPPKYEDVVQLSAPDPGQFQTIELQDNKHSSRK
TDTVKSIPNNSTNSLYNLEINDPRTLKDVQFQSPSLTMNALGNVSSGDLMETLYIEEESD
GKKAVGKGQRKENGLSQELLKVNEDRAEFSDHGSHLKKCPASVQNEIGKIFEKPIVNLPK
EDLKSEVPKVEEDHRDFMNSNSKEEIDKLLMDLESFSQRMETSLREPLAKGKNSNSLNNH
SPLTDQLPVDLEPKSKASSPMEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIEDFAQ
ELVECKSGRGSLSQEKEMMQILQETLTNSSQANLSVCKSPVGGKVKDTTSVVLIQQTPEV
IKIQNKPEKKPGTPLPPPATFPSTPQPPSPVPHVSKVVNAPLSINIPRFYFPEGLPDACS
NHEQTLSRIEAAFMDIEDQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVSAQSF
IAMWRKLLNKHHDDASKFICLLAKPSCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHS
RYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVI
YCKFWELDSDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTVQQEGRMSYADFVW
FLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLC
QMLDLVKPASDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDMPEP
SDWDRFAAEEYETLVAEESAQAQFQEGSFEDYETEEPASPSEIGNKGNKTVTSSLSEKCG
KLQSVDEE
NT seq 3447 nt   +upstreamnt  +downstreamnt
atggcagcaacttacagacttgtggttagtactgtgaaccactacagcagcgtggtgata
gaccggcgttttgagcaagctatacattactgcactggaagctgccacaccttcacacat
ggagttgactgccttgtggtacatcgtagtgtttgtgcagacttgcacatccctgtatct
cagttcaaagatacagatctggactccatgtttctaccccatgaaaatgggttttcctca
gctgaaagtgactatccccatcaggccctcacaggcatacgggtcaaaaaaggatctacg
cttcaaaatacctgtaacttaaaggacattgcaggagaagcaatcagttttgccagtggg
aaaataaaagaattttcccttgaaaaactcaaaaactctaaccatgcagcttacaaaaag
ggaagaaaagttaagtctgactcatttaataggaggtcagttgattttgacttgctctgt
ggccattataacagtgatgggaactcatcatcctttggtttactccggagttcctcagtt
gaggaaaaatctttgtcccatagaaactcactcgatatgaatctgacttcgatgtttctt
cacaacttctctgaagaagacctggttactcagattttggaaaaacataaaatagataac
ttttcttctggaacagacataaagatgtgcttggacatcttgctgaaatgctctgaggat
ttgaaaaaatgcacagacattataaaacaatgcataaagaaaaaatcagatagtagcatc
aatgaaggaaatggtaatgatgcagtttctagctctgaaactgtctatatgaatgtaatg
accagattagcatcctatctgaaaaagctgccatttgaattcatgcagtctgggaataat
gaggctatagatttaacagaactggttagtaatatgcctagtttacaactgactcccttc
tccccaatatttggcactgagcagccccctaaatatgaagatgttgtccagctctcagcc
cctgaccctggacagtttcaaactatagaattgcaagataacaagcatagttctaggaaa
acagacactgtaaaatccattccgaacaactctacgaattccttatataacttagagata
aatgatcccagaactctaaaagatgtccagtttcagtcaccgtcattaaccatgaatgct
ttaggaaatgtttcttctggtgatctaatggaaaccctttatattgaagaagagtcagat
ggaaagaaagcagtaggtaaaggacaaaggaaagagaatggactcagtcaagagttgtta
aaggtaaatgaagatagagccgaattttcagaccatggtagtcatcttaaaaaatgtcct
gcctcagtacaaaatgaaattggtaagatatttgagaaaccaattgttaatctacctaag
gaagatcttaagtcagaagttcctaaagtcgaggaagaccacagagattttatgaattct
aacagtaaggaagagatagataaattgttaatggacttggaatctttttcacagagaatg
gagacctctctaagagagccacttgccaaaggtaaaaactctaactctctaaataatcat
agtccgttgactgatcagctgcctgtagatcttgagcctaaatctaaagcctcttcaccc
atggagaaagtctcaccttcctgtctaacaaggatcattgaaaccaatggacacaaaata
gaggaagaggaccgagccctcttgctacgaattctagaaagcattgaagactttgctcag
gaactggtcgaatgcaaatcaggcagagggagcttatcacaagaaaaggaaatgatgcag
attctacaggaaaccttgactaattcttcccaggccaatttatcagtctgtaaaagtcct
gttggtggtaaagtgaaagatactacttcggtggttttgattcagcaaactccagaggtg
atcaagattcaaaataaaccagaaaagaaacctggaacaccactaccacctccagccacc
tttccaagtaccccccagcctccctcccctgttcctcatgtgagtaaggttgtgaatgca
ccattgtccatcaacattccacggttctactttcccgaaggactcccagatgcctgcagt
aaccatgaacagactctaagcagaattgaagctgctttcatggacattgaagatcagaaa
gcagatatttatgaaatggggaaaattgccaaggtctgtggctgtcctctctattggaaa
gcccccatgttcagggctgcagggggagagaagacaggatttgtgtcagcacagtctttt
attgccatgtggagaaagttgctaaataaacatcatgatgatgcctctaagtttatctgt
cttctcgcaaagcccagctgcagctctctagaacaggaggactttatccctttacttcag
gatgtggtggatacacaccctggcctcacgttcctgaaagatgctccagaattccactcc
cgctacatcaccacggttattcagcgaatattctacacagtgaacaggtcttggagcgga
aaaattacttcgacggagataaggaaaagcaactttttgcaaacactagcccttttggaa
gaagaggaagatataaaccaaatcacagactacttttcctatgaacatttttatgttatt
tattgtaaattctgggaactagatagtgaccatgacctctacatcagccaagctgatcta
tctcgatacaatgaccaggcttcatcaaacagaattattgaaaggatattctctggggca
gtaacaaggggaaaaacagtacagcaagagggaagaatgagctatgcagattttgtttgg
tttttgatatctgaggaagacaaaaggaaccccaccagcattgagtattggttccgctgc
atggatgtggatggggatggtgtgctttccatgtacgagctcgagtacttctacgaggag
cagtgtgaacggatggaagccatgggcatcgagcccttgccgttccatgatttgctgtgc
cagatgcttgacctggtgaagccagccagtgatggcaaaataactctacgagatctgaag
agatgcagaatggctcacatcttttatgacactttctttaatctggagaaatacttagac
catgaacagagagatccctttgcagtccagaaggacgtggagaatgacatgcctgagccc
tccgactgggacaggtttgctgctgaggagtatgagacccttgtagcagaggagtctgcc
caagcacagttccaggaaggttcttttgaagattatgaaacagaggaacctgcctctccc
tctgaaattggaaacaaaggcaataaaacagtaacctcaagcctttcagagaaatgtgga
aagcttcagtcagtggatgaagaatag

DBGET integrated database retrieval system