KEGG   Miniopterus natalensis: 107524200
Entry
107524200         CDS       T05883                                 

Gene name
AQP4
Definition
(RefSeq) aquaporin-4
  KO
K09866  aquaporin-4
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107524200 (AQP4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107524200 (AQP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107524200 (AQP4)
Transporters [BR:mna02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    107524200 (AQP4)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107524200
NCBI-ProteinID: XP_016051479
LinkDB
Position
Unknown
AA seq 323 aa
MSDRPAARRWGKCGPLCRREDIMVAFRGVWTQAFWKAVTAEFLAMFIFVLLSLGSTINWG
GAEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIA
AQCLGAILGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDS
KRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
AVLAAGLYEYVFCPDVELKRRFKEAFSKAAQQTKGSYVEVEDNRSQVETEDLILKPGVVH
VIDIDRGEEKKGKDPSGEVLSSV
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagtgacagacccgcagcaaggcggtggggtaagtgtggacctttgtgcagaagagag
gacatcatggtggccttcagaggggtctggactcaagctttctggaaggctgtcaccgcg
gaattcctggccatgtttatttttgttctgctaagcctgggatccaccatcaactggggt
ggagcggaaaagcccctgcccgtcgacatggtccttatctccctttgctttggactcagc
attgccactatggtgcagtgcttcggccacatcagtggcggccacatcaaccctgctgtg
acggtggccatggtgtgcaccaggaagatcagcatcgccaagtctgtcttctacatcgca
gcccagtgcctgggcgccattcttggagccgggattctctaccttgtcacacctcccagc
gtggtgggggggttgggggtcaccacggttcacggaaacctcactgctggtcatggtctc
ctggtggagttgataattacatttcagttggtgtttactatttttgccagctgtgattcc
aaacggactgatgtcactggttcaatagctttagcaattggattttctgttgcaattgga
catttatttgcaatcaattacactggtgccagcatgaaccctgcccgatccttcggacct
gcagttatcatgggaaactgggaaaaccattggatatattgggttggaccaataatagga
gctgtgcttgctgctggcctttatgagtatgtcttctgtccagatgttgaactcaagcgt
cgttttaaagaagccttcagcaaagctgctcagcaaaccaaagggagctacgtggaggtg
gaagacaacaggagtcaggtagagaccgaggacttgattctaaaacctggagtggtgcac
gtgattgacattgaccggggtgaggaaaagaaggggaaagacccatcaggagaagtgttg
tcttccgtatga

DBGET integrated database retrieval system