KEGG   Miniopterus natalensis: 107524205
Entry
107524205         CDS       T05883                                 

Gene name
TTR
Definition
(RefSeq) transthyretin
  KO
K20731  transthyretin
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107524205 (TTR)
Transporters [BR:mna02000]
 Other transporters
  Others
   107524205 (TTR)
SSDB
Motif
Pfam: Transthyretin
Other DBs
NCBI-GeneID: 107524205
NCBI-ProteinID: XP_016051482
LinkDB
Position
Unknown
AA seq 147 aa
MASLRPLLLGLAALVLVSEAGPAGTGESKCPLMVKVLDAVRGSPAVNVAVKVFKKAADGT
WEPFASGKTSDFGELHGLTTSDKFVEGIYKVELDTKSYWKALGISPFHEYAEVVFTANDS
GQRQYTIAALLSPYSYSTTALVSGPKE
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcttctctgcgcccgctgctcctcggcctcgctgcgctggtgcttgtgtctgaggcc
ggccctgcgggcactggggaatccaagtgtcctctgatggtcaaggtcctagatgccgtc
cgaggcagccctgctgtcaacgtggccgtgaaagtcttcaaaaaggctgccgatgggacc
tgggagccgttcgcctctgggaaaaccagtgactttggagagctccatggactaacaact
agtgataaatttgtagaagggatatacaaagtggaattagacaccaaatcctactggaag
gcacttggcatttccccgttccatgagtatgcagaggtggtgttcacagcgaacgactct
ggccaacgccagtacaccattgctgctctgctcagcccctactcttactccaccacagcc
ctcgtcagtggccccaaagaatga

DBGET integrated database retrieval system