KEGG   Miniopterus natalensis: 107524243
Entry
107524243         CDS       T05883                                 

Gene name
AGT
Definition
(RefSeq) angiotensinogen
  KO
K09821  angiotensinogen
Organism
mna  Miniopterus natalensis
Pathway
mna04072  Phospholipase D signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04614  Renin-angiotensin system
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04931  Insulin resistance
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna05200  Pathways in cancer
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    107524243 (AGT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107524243 (AGT)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107524243 (AGT)
   04614 Renin-angiotensin system
    107524243 (AGT)
   04925 Aldosterone synthesis and secretion
    107524243 (AGT)
   04927 Cortisol synthesis and secretion
    107524243 (AGT)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107524243 (AGT)
   04270 Vascular smooth muscle contraction
    107524243 (AGT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524243 (AGT)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107524243 (AGT)
   05414 Dilated cardiomyopathy
    107524243 (AGT)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107524243 (AGT)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107524243 (AGT)
   04934 Cushing syndrome
    107524243 (AGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107524243 (AGT)
Peptidases and inhibitors [BR:mna01002]
 Peptidase inhibitors
  Family I4: serpin family
   107524243 (AGT)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 107524243
NCBI-ProteinID: XP_016051540
LinkDB
Position
Unknown
AA seq 477 aa
MRPAGVGLRATMLCLLAWAGLPTADRVYIHPFHLLVYSKSTCEQLEKPNGETPKDQTLTP
LPIQNEVPPVDEESLREKLVLAAQKLRGEDKMRVTMVGMLLNFMGFRMYKMLTETQTDDS
VAILSPTALFGTLTSFYLGALGTTASRLQTFLGVPGEDLSCTSQLDGHKVLSTLQAIQGL
LVLQDRAGHPARLRLSTVVGLFTNDGLRLKRPFVQGLAPFAPVTLPRSLDLSRDPNLACE
LINRFMQAATGWNMGRPLREGSPDSSLLFNAYIHFQGQMKGFSLLPSLQEFWVDNTTSVS
VPMLSGMGTFQHWRDTRNNLSMTQVPLSKNVGLLLIQPHLASALEEVEALTFQRDFMTWT
KNLSPRAIHLTMPQLVLRGSYDLQELLAQAKLPTLLGPEANLYKISSDKLRVGQVMNSIL
FELKADQGEQPAGSAQQPAGPGALEVTLNRPFLFAVYDQDSTALHFLGRVANPLRVV
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgcgtcctgcgggtgtgggcctgagggccaccatgctttgtctgctggcctgggctggc
ctgcccactgctgaccgggtctatatacaccccttccacctccttgtctacagcaagagc
acctgcgaacagctggagaagcccaatggggagacgcccaaagaccaaaccctcacgcct
ctccccattcagaacgaggtgcccccagtagacgaagagagcctgcgggagaagctagtg
ctggctgcccagaagctccggggtgaagacaagatgcgggtgaccatggtggggatgctc
ctcaatttcatgggcttccgcatgtacaagatgctgaccgagacacagaccgacgacagc
gtggccatcctctccccaacagctctctttggcaccctgacctccttctacctgggagct
ttgggcaccacggccagcaggctgcagactttcctgggcgtccccggggaggatctcagc
tgcacctcccagctggatggtcacaaggtcctctcgaccctgcaggccattcagggcctt
ctggtcttgcaggacagggctggccacccggccaggctgcgcctgtccaccgtggtgggc
ctgttcaccaacgatggcctgcgcctgaagaggcctttcgtgcagggcctggctcccttc
gcccccgtcaccctcccgcgctctctcgacctgtccagggacccaaacctcgcttgtgag
ctgatcaacaggttcatgcaggccgccaccgggtggaatatgggcaggcccctgagggaa
ggcagccccgacagctccctgctcttcaacgcttacatccacttccaaggccagatgaag
gggttctccctgctgcccagcctccaggagttctgggtggacaataccacctccgtctcc
gtccccatgctctcgggaatgggcaccttccagcactggagggacacccggaacaacctc
tccatgacccaggtgcccctcagcaagaacgtcggcctgctgctgatccagccccacctc
gcctcagccctggaggaggttgaggccctcaccttccagcgcgacttcatgacctggact
aagaacctgtctccccgggccatccacctgaccatgccccagctggtgctgcgagggtcc
tacgatctgcaggaactgctcgcccaggccaagctgcccaccctgctgggccccgaggca
aacctgtacaaaatcagcagtgacaaactcagagtcggacaggtgatgaacagcatcctg
ttcgaactcaaagcagaccagggagagcagcccgcagggtctgcccagcagccggcaggc
cccggggccctggaggtgaccctgaaccgcccgttcctgtttgccgtctatgaccaagac
tccactgccctccacttcctgggccgtgtggccaacccactgagggtggtgtga

DBGET integrated database retrieval system