KEGG   Miniopterus natalensis: 107524266Help
Entry
107524266         CDS       T05883                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04670  Leukocyte transendothelial migration
mna04916  Melanogenesis
mna04919  Thyroid hormone signaling pathway
mna04934  Cushing syndrome
mna05100  Bacterial invasion of epithelial cells
mna05160  Hepatitis C
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107524266 (CTNNB1)
   04310 Wnt signaling pathway
    107524266 (CTNNB1)
   04390 Hippo signaling pathway
    107524266 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107524266 (CTNNB1)
   04520 Adherens junction
    107524266 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107524266 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107524266 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107524266 (CTNNB1)
   04916 Melanogenesis
    107524266 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524266 (CTNNB1)
   05205 Proteoglycans in cancer
    107524266 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107524266 (CTNNB1)
   05225 Hepatocellular carcinoma
    107524266 (CTNNB1)
   05226 Gastric cancer
    107524266 (CTNNB1)
   05216 Thyroid cancer
    107524266 (CTNNB1)
   05217 Basal cell carcinoma
    107524266 (CTNNB1)
   05215 Prostate cancer
    107524266 (CTNNB1)
   05213 Endometrial cancer
    107524266 (CTNNB1)
   05224 Breast cancer
    107524266 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107524266 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    107524266 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107524266 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107524266 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107524266 (CTNNB1)
   05163 Human cytomegalovirus infection
    107524266 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107524266 (CTNNB1)
   05165 Human papillomavirus infection
    107524266 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 107524266
NCBI-ProteinID: XP_016051589
LinkDB All DBs
Position
Unknown
AA seq 782 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEDEDADTT
QQVLYEWEQGFSQPFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHP
TNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLS
KKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPA
LVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTD
CLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVE
AGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTC
AAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAE
MAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQL
LVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLF
VQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVL
FRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSF
HSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDT
DL
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggcgccact
accacagcgccatctctgagtggtaaaggcaatcccgaggacgaagatgcagacaccacc
cagcaagtcctgtacgagtgggagcagggcttttcccagcccttcactcaggagcaagta
gctgatattgatggacagtatgcgatgactcgagctcagagggtgcgagctgctatgttc
cctgagacattagatgagggcatgcagatcccatctacacagttcgatgccgctcatccc
accaatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaatttg
attaactatcaagacgatgcagaacttgccacgcgtgcaatcccagaactgacaaaactg
ctgaatgatgaggaccaggtggtggttaacaaggctgcagttatggtccatcagctttct
aaaaaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgta
cgtaccatgcagaatacaaatgatgtggaaacagctcgctgtactgctgggaccttgcac
aatctctcccaccatcgtgagggcttgctggccatctttaagtctgggggtattcctgcc
ctggtgaagatgcttggctcaccagtggattcagtactgttttatgccattacaactctc
cacaacctcttattgcatcaagaaggagctaaaatggcagtgcgtttagctggcgggctg
cagaaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagac
tgccttcagattttagcttatggcaatcaggaaagcaagctgatcatcctggctagtggt
ggaccccaagctttggtaaatataatgaggacctacacttatgagaaactactgtggacc
acaagcagagtcctgaaggtgctgtctgtctgctccagtaataaaccggctattgtagaa
gctggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcag
aactgtctttggactcttaggaatctttcagatgctgcaactaagcaggaaggaatggaa
ggtcttcttgggacccttgttcagctgctgggctcagatgacataaacgtggtcacctgt
gcagctggaattctttctaatctcacctgcaataactataagaacaagatgatggtgtgc
caagtgggtggcatagaggctctggtgcgtactgtccttcgtgctggtgacagggaggac
atcaccgagccggccatctgtgctcttcgtcacctgaccagccgacaccaggaagcagag
atggcccagaacgctgttcgccttcactatggactaccagttgtagttaaactcctacac
ccaccatcccactggcctctgataaaggctaccgttggattgattcgaaatcttgccctt
tgtccagcaaatcacgcccctttgcgggagcagggcgccattccacggctggttcagctg
ctagtacgtgcacatcaggacacccagcgtcgtacgtctatgggcgggacacagcagcag
tttgtggagggggtccgcatggaagaaatagttgaaggttgtactggagccctgcacatc
ctagctcgggatgttcacaaccgaattgtaatcagaggactgaataccattccactgttt
gtgcagctgctctattcccccattgaaaacatccagagagtggccgcgggggtgctctgc
gaactggcgcaggacaaggaggccgcggaagcgatcgaggccgagggcgccacggcgccc
ctcacggagctgctgcactcgaggaacgagggcgtggcaacgtatgcggctgctgtcttg
ttccggatgtccgaggacaagccgcaggactacaagaagcggctttccgtcgagctgacc
agctctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgat
attggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttctttt
cactccggtggctatggccaggatgccttgggaatggaccccatgatggagcatgagatg
ggtggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcacgcc
caggacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatact
gacctgtaa

DBGET integrated database retrieval system