KEGG   Miniopterus natalensis: 107524268
Entry
107524268         CDS       T05883                                 

Gene name
ANO10
Definition
(RefSeq) anoctamin-10
  KO
K19327  anoctamin-10
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107524268 (ANO10)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107524268 (ANO10)
SSDB
Motif
Pfam: Anoctamin CoV_NSP15_C
Other DBs
NCBI-GeneID: 107524268
NCBI-ProteinID: XP_016051601
LinkDB
Position
Unknown
AA seq 656 aa
MRVTLSALDTYEGSFTPLVVIELAQDVKEETKEWLKNRIITKKKDGGAQLLFRPLLNKYE
KETVENQNLYLVGASNIRLLLGAEAVGLVKECHDNAMRAFTYGTRHNFKGFDDNNDDFLT
MAESQFIIKHELENLRARDEKMIPGYPQAKLYPGKSLLRRLLTSGIVVQVFPLHDNEALK
KLEDTWYTRFNFKCQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVVFASFNLIWSTVILEVWKRGCASMTYRWGTLVMKRQFEEPRPGFHGVLGINSITGR
EEPLYPSYKRQLRIYLVSLPFVCLCLYFSLYVMMIYFDMEAWALDLHENSGSEWTSILLY
VPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHLILKVLVFNFLNCFASLFYIA
FVLRDMKLLRQSLATLLIMSQILNQVMESLLPYWLQRKHHVRVKKRVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELLLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRV
FKRPFSEPSASIGVWQLAFETMSVISVVTNCALIGMSPQVNALFPESKADLILIVVAVEH
ALLALKFILAFAIPDKPRHIQTKLARLEFESLEALKQQQMKLVAENLKEEGKGMAT
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgagagtgaccttatcagctttggatacttatgagggttctttcacgcctttggtggtc
atagaacttgctcaggatgtcaaagaggaaaccaaggaatggctgaaaaacagaattatc
actaaaaagaaagatggaggtgcccagctgttgtttagaccgttgctaaataaatatgag
aaagaaacggtggaaaatcagaacctgtatcttgttggcgcctccaatattaggttgtta
ctgggggcagaagccgtggggctggtgaaggagtgtcatgataacgccatgagggccttc
acctatgggacccgacacaacttcaaaggctttgatgataacaatgatgattttctcacc
atggcagaaagtcaattcattatcaaacatgaacttgaaaatcttagagccagagatgaa
aaaatgatccctggttacccccaggcaaagttatacccaggaaaatcattattgaggaga
ctgctcacgtctggcatcgtggtccaggtgttcccgctgcatgacaacgaagccctgaag
aagctcgaggacacctggtacactcggtttaatttcaagtgtcagcccatagacagtatt
cgtggctactttggggagacgattgctctgtactttggatttttggagtattttactttt
gccttgatccccatggcagtcatcgggctgccttattacttgtttgtgtgggaggattat
gacaagtacgtggtctttgcctcgttcaacctgatctggtccacggtgatcctggaagtg
tggaagcgtggctgtgccagcatgacctacaggtgggggaccctggtcatgaagaggcag
ttcgaggagccccggccaggattccacggcgtcctgggcatcaactccatcacgggcagg
gaggagcccctctaccccagctacaagcgacagctgcgcatttacctggtctccctgccc
ttcgtgtgcctctgcctctatttctctctgtatgtcatgatgatttacttcgacatggag
gcctgggccttggatctccacgagaacagcgggtctgagtggaccagcatcctgttgtat
gtgcccagcatcatctatgccatcgtgattgagatcatgaaccgcctctatcgatacgcg
gcggagttcttaacctcctgggagaatcacagattggaatctgcctaccagaatcatcta
attttgaaagtgttagtgttcaacttcctgaattgctttgcctcgctcttctacattgcc
tttgtcctgagggatatgaagctcttgcgccagagcctggccacgctcctgattatgtcc
cagatccttaaccaggtgatggagtctctccttccctactggctccagaggaagcaccac
gtgcgggtgaaaaagagggtgcaggctctgaaggccgacattgatgctacgctctatgaa
caggtcatcctggaaaaagaaatgggaacttatttgggcacctttgacgactacctggag
ctgctgctgcagtttggatacgtgagccttttctcctgtgtttacccactagcagcggcc
tttgctgtgctaaataacttcactgaagttaactcagatgccttaaaaatgtgcagagtc
ttcaaacgtccgttctcagagccttcagccagtattggtgtgtggcagttggcttttgaa
acaatgagtgtcatatctgtggtcactaactgtgccctgatcggaatgtcaccgcaagtg
aatgcactgttcccggagtccaaagcggacctcattttgattgtagtagcagtggagcac
gctctcctggcactgaagttcatccttgcctttgccatccctgataaaccacggcacatc
cagacgaaactggccaggttggaatttgagtccttggaggcactgaagcagcagcagatg
aagcttgtggccgagaacctgaaggaagaagggaaggggatggcgacctga

DBGET integrated database retrieval system